KEGG   Lactobacillus casei W56: BN194_22160Help
Entry
BN194_22160       CDS       T02337                                 

Gene name
agaS_2
Definition
alpha-galactosidase 2 (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lcw  Lactobacillus casei W56
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:lcw00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BN194_22160 (agaS_2)
  Lipid metabolism
   00561 Glycerolipid metabolism
    BN194_22160 (agaS_2)
   00600 Sphingolipid metabolism
    BN194_22160 (agaS_2)
Enzymes [BR:lcw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BN194_22160 (agaS_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2194456..2196678
Genome map
AA seq 740 aa AA seqDB search
MANIEYDPERQLFHLHNDTFSYVIQVIRGYLVKRYCGPALDHFSGTAKLEDFSHAFNIQN
DAAPYSLTTLPLEYSTLMGGDYRTPAYAVRNGHGQLIGNLKFDHYQILAGNESFNGTLPT
ARTPHGQTLIITMHDETQTLAVRLKYTIVGDLPVLLKQVEYRNLTDTTLTITHAASLQLD
FDDHAYDLITLTGAHLNEAKVTRQPLTPGKKSIGSNYGASGPQGVPATILAAPATNEFAG
EALGVTLLWSGNFNYTAQVDQFDNSRLVMGLNPELFAWQLKPGKPFVTPEAAVAYTNDGL
NDLSRIFHRFFADHVMPLPRKNLIEYNTWETTYFDVSEAKILAEIPKAEELGVELLVIDD
GWFKNRPNDAGQLGDWVPDPAKFPHGLRPVADAIHARGLAFGLWVEPEMISENSELYATH
PDWAMQYVGQKPLRSRNQLILDLSQRIVQDHLITVLTNLVRDNHIDYLKWDYNRHFSQPG
SPVLPPDQQGEVGYRYTRGLYRVLKTLRDTFPKLLIENCSSGGGRLDGGMIAYTDQTWTS
DFTDPVYRMKIMNGFSLFFPLKIFVSHFTASPNLQDARLTPLHTRALLSLVGITGIECPP
SQLSPAEAAAVKASFAFYKANRKELQNGLLFRLQPSHVNQDEVCWLITNAAKTNALVLTS
VGVTSPIPHYQHVLLHYLDPKLSYQIDKTKNATGLELNHAGVTLPLAHGDFSATLMELTA
VTNLPQTTAAPTLDQITTQS
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatattgaatatgatccggaacgtcaattatttcatttgcacaacgacaccttt
agctatgtcattcaagttattcgcggttatcttgttaaacgatactgcggaccggcgctg
gatcatttttccggtaccgccaaacttgaagacttcagccatgcttttaacattcaaaat
gatgccgcaccttactcactgacgaccttgccgctggaatatagcacattgatgggcggc
gattaccggacgccagcttacgccgtgcgtaacggtcacggtcagctgattggtaatctc
aagtttgaccactatcaaatccttgcaggcaatgaaagctttaacggtaccttgccgaca
gcgcggacaccgcacgggcaaacgctgatcataacgatgcacgatgaaacccagacgctt
gctgtccggctcaaatacacgattgtcggcgatttgcctgtcttgctcaaacaagttgag
tatcgtaatctgacagacacgacactgacgattactcatgctgccagccttcaactggat
tttgacgaccacgcttatgacctcattacgctgaccggtgctcatctcaatgaggccaaa
gtgacccgccagccgctgacccccggcaaaaagtcaatcggcagtaattatggcgccagt
gggccgcaaggtgtcccggcgacgattcttgcagcgccagcgaccaatgaatttgctggg
gaagctttaggcgtcacgcttttgtggagcggcaattttaactatacggcgcaagtcgat
cagttcgacaacagccggctcgtgatgggactgaatccggagctctttgcttggcagctc
aagcccggcaagccatttgtcacgccggaagcagccgtcgcttacaccaacgatggccta
aatgatctcagccggatcttccaccgcttttttgccgatcatgtcatgccattgccgcgc
aaaaacctaattgaatacaacacgtgggaaaccacttattttgacgttagcgaagccaaa
attctagccgagattcccaaagccgaagagttaggagttgagttactggtcattgatgat
ggctggttcaaaaatcggcctaacgatgctggccaacttggcgactgggtacctgatccc
gctaagtttccacatggcctgcgcccggtggctgacgcaattcacgctcgcggccttgct
tttgggctttgggtcgaacccgaaatgatcagcgaaaatagtgagctctatgccacccat
cctgactgggccatgcagtatgtcggccaaaaacctctgcgttctcgcaatcagcttatt
ctcgatctcagtcagcggattgtgcaggatcacttgatcacagttctaactaacctcgtg
cgcgataatcatattgattacctcaagtgggactataaccgccacttcagtcaacctggc
agtccggtactgccacctgatcaacaaggtgaagtcggctatcgctatacccgcggctta
tatcgggttttgaaaacgttacgcgacacttttccaaagctactcatcgaaaattgttcg
tccggcggtggccgtttagatggcgggatgatcgcctacaccgaccaaacatggaccagc
gattttactgacccggtttaccgcatgaaaattatgaacggcttctcgctgtttttcccg
ctcaaaatttttgtctcgcatttcaccgcctccccgaatctacaagatgcgcggttaacg
cccttgcatacccgcgcactgttaagtctggttggcatcactggcatcgaatgcccgccg
agtcagctcagtcccgctgaagccgcggcggtcaaggccagttttgccttttacaaagcg
aatcgcaaagaattgcagaatggtttgctttttcggttacaacctagccatgttaatcaa
gacgaggtttgttggctgatcactaacgccgccaaaaccaatgcactggtcttgacttca
gtcggtgtcacttcgccgattcctcattatcaacatgtactgctgcattacttggaccca
aaattgtcttatcaaatcgacaagacaaaaaatgccaccgggttagaacttaaccacgcc
ggtgttaccttgccacttgcccatggtgatttttcggcaacgctcatggagctgacggcg
gtaaccaaccttccgcaaaccaccgcagcaccgacgcttgatcaaataaccacgcaaagt
tag

DBGET integrated database retrieval system