KEGG   Lactobacillus casei W56: BN194_22890Help
Entry
BN194_22890       CDS       T02337                                 

Gene name
THNSL1
Definition
threonine synthase-like 1
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lcw  Lactobacillus casei W56
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lcw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN194_22890 (THNSL1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN194_22890 (THNSL1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BN194_22890 (THNSL1)
Enzymes [BR:lcw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BN194_22890 (THNSL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2274175..2275704)
Genome map
AA seq 509 aa AA seqDB search
MGVLQMRYTSTRDHQVSKTSKEAIKQGISEEGGLFVLPHLADQTLNIHELLDLDYETIAQ
RVLMILLPDFNTDSLKKAIHFAYHQHFSDDRITPVRSVGDFHVLELFHGPTSAFKDVGLQ
LLPRLMQLALDPDDRVMILAATSGDTGTAALQGFKDVAQTGITVFYPNHGVSPIQERQML
TVGSDNTRVFPIAGNFDQAQSAVKTLFTDTSFAARLQAEQVTLSAANSINIGRLIPQVVY
YFAAYSQLVKTQAISMGDEVNFTVPTGNFGDVLAGYYAKSLGLPVHKLIVAANANSELAD
FLATGVYDRNRPFLKTVAPSMDIQISSNLERLLYYKSGEDSAYVAHLMQELETTGRYQVR
PDVLTAIQADFAGGFAVDEEVADAIREVWHRDGYLLDPHTAVGYAVQQQYRAASGDNTPN
VLLATASPYKFPRVVAKALQSHVPDDDFAAMQMLQQVSGVPIPPNLARLQQLRPQEKIVV
APTDMGQAIIGAAKEVFNDDQRVRSGNER
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ataggagttcttcaaatgcgatatacgagcacacgggatcatcaagttagcaaaaccagc
aaagaggcaatcaaacaaggtatttctgaagaaggcggtttgtttgtcctgccgcatttg
gccgatcagacgctgaacattcatgaactgttagatttagattatgaaacgattgctcag
cgagttctcatgatcctgttgcctgattttaacaccgactcactaaaaaaagcgattcat
tttgcgtatcatcagcatttttccgatgatcgcatcacgccagttcgttctgtcggggat
tttcatgtcttagagttatttcatggaccaaccagtgcctttaaggatgtcggcttgcag
ttgcttccgcgcttgatgcagttggcacttgatcctgatgatcgggtcatgattttagcg
gcaaccagcggtgatacgggaacggcggctctgcaagggtttaaagatgtcgcgcagact
gggatcacggttttctatcctaatcatggtgtcagtccaattcaggagcgccaaatgttg
accgtgggcagtgacaatacgcgagttttcccaatcgctggcaattttgatcaggcccaa
agcgcagtgaaaaccctgttcactgacactagctttgctgctcggttgcaggcagagcaa
gtaaccctgtcagcagccaactccatcaatattggccgactgattccgcaagttgtgtat
tattttgcagcgtatagccagctggttaaaacacaggccatttcaatgggagatgaggtt
aatttcactgttccaactgggaattttggcgatgtgttggcgggctactatgctaagagt
ctaggcttgcctgttcataaactaatcgtggccgccaatgccaacagcgaattggctgat
tttctggcaaccggtgtgtatgatcgcaaccgaccgtttttgaaaacagtggcacctagc
atggatattcaaatttccagtaatctggaacgcctgttgtattataagagtggcgaagat
agcgcgtatgttgcgcatttaatgcaggaacttgagacgactggtcgctatcaagttcgg
ccggatgtgttgaccgcgattcaagcggactttgctggcggttttgctgttgatgaagag
gtggcagatgccattcgcgaggtttggcatcgggatgggtatttgctggatccgcacact
gctgttggttatgcggttcaacagcagtaccgggcggcgtctggggataacaccccgaat
gtgcttttagccaccgcaagcccttataaatttccacgcgtggtggccaaggcactacaa
tcgcacgtaccggatgatgactttgctgcgatgcaaatgttgcaacaggttagcggtgtg
ccgattccgccgaatcttgctcgccttcaacagctaagaccgcaggaaaagattgttgtg
gcaccaaccgatatgggccaagctattattggggcggcgaaggaggtattcaacgatgat
cagcgtgtccgttccggcaacgagcgctaa

DBGET integrated database retrieval system