KEGG   Lactobacillus casei W56: BN194_22890Help
Entry
BN194_22890       CDS       T02337                                 

Gene name
THNSL1
Definition
(RefSeq) threonine synthase-like 1
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lcw  Lactobacillus casei W56
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lcw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN194_22890 (THNSL1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN194_22890 (THNSL1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BN194_22890 (THNSL1)
Enzymes [BR:lcw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BN194_22890 (THNSL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2274175..2275704)
Genome map
AA seq 509 aa AA seqDB search
MGVLQMRYTSTRDHQVSKTSKEAIKQGISEEGGLFVLPHLADQTLNIHELLDLDYETIAQ
RVLMILLPDFNTDSLKKAIHFAYHQHFSDDRITPVRSVGDFHVLELFHGPTSAFKDVGLQ
LLPRLMQLALDPDDRVMILAATSGDTGTAALQGFKDVAQTGITVFYPNHGVSPIQERQML
TVGSDNTRVFPIAGNFDQAQSAVKTLFTDTSFAARLQAEQVTLSAANSINIGRLIPQVVY
YFAAYSQLVKTQAISMGDEVNFTVPTGNFGDVLAGYYAKSLGLPVHKLIVAANANSELAD
FLATGVYDRNRPFLKTVAPSMDIQISSNLERLLYYKSGEDSAYVAHLMQELETTGRYQVR
PDVLTAIQADFAGGFAVDEEVADAIREVWHRDGYLLDPHTAVGYAVQQQYRAASGDNTPN
VLLATASPYKFPRVVAKALQSHVPDDDFAAMQMLQQVSGVPIPPNLARLQQLRPQEKIVV
APTDMGQAIIGAAKEVFNDDQRVRSGNER
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ataggagttcttcaaatgcgatatacgagcacacgggatcatcaagttagcaaaaccagc
aaagaggcaatcaaacaaggtatttctgaagaaggcggtttgtttgtcctgccgcatttg
gccgatcagacgctgaacattcatgaactgttagatttagattatgaaacgattgctcag
cgagttctcatgatcctgttgcctgattttaacaccgactcactaaaaaaagcgattcat
tttgcgtatcatcagcatttttccgatgatcgcatcacgccagttcgttctgtcggggat
tttcatgtcttagagttatttcatggaccaaccagtgcctttaaggatgtcggcttgcag
ttgcttccgcgcttgatgcagttggcacttgatcctgatgatcgggtcatgattttagcg
gcaaccagcggtgatacgggaacggcggctctgcaagggtttaaagatgtcgcgcagact
gggatcacggttttctatcctaatcatggtgtcagtccaattcaggagcgccaaatgttg
accgtgggcagtgacaatacgcgagttttcccaatcgctggcaattttgatcaggcccaa
agcgcagtgaaaaccctgttcactgacactagctttgctgctcggttgcaggcagagcaa
gtaaccctgtcagcagccaactccatcaatattggccgactgattccgcaagttgtgtat
tattttgcagcgtatagccagctggttaaaacacaggccatttcaatgggagatgaggtt
aatttcactgttccaactgggaattttggcgatgtgttggcgggctactatgctaagagt
ctaggcttgcctgttcataaactaatcgtggccgccaatgccaacagcgaattggctgat
tttctggcaaccggtgtgtatgatcgcaaccgaccgtttttgaaaacagtggcacctagc
atggatattcaaatttccagtaatctggaacgcctgttgtattataagagtggcgaagat
agcgcgtatgttgcgcatttaatgcaggaacttgagacgactggtcgctatcaagttcgg
ccggatgtgttgaccgcgattcaagcggactttgctggcggttttgctgttgatgaagag
gtggcagatgccattcgcgaggtttggcatcgggatgggtatttgctggatccgcacact
gctgttggttatgcggttcaacagcagtaccgggcggcgtctggggataacaccccgaat
gtgcttttagccaccgcaagcccttataaatttccacgcgtggtggccaaggcactacaa
tcgcacgtaccggatgatgactttgctgcgatgcaaatgttgcaacaggttagcggtgtg
ccgattccgccgaatcttgctcgccttcaacagctaagaccgcaggaaaagattgttgtg
gcaccaaccgatatgggccaagctattattggggcggcgaaggaggtattcaacgatgat
cagcgtgtccgttccggcaacgagcgctaa

DBGET integrated database retrieval system