KEGG   Lactobacillus casei W56: BN194_22990Help
Entry
BN194_22990       CDS       T02337                                 

Gene name
asnB
Definition
asparagine synthetase [glutamine-hydrolyzing] 1 (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lcw  Lactobacillus casei W56
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lcw00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN194_22990 (asnB)
Enzymes [BR:lcw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BN194_22990 (asnB)
Peptidases [BR:lcw01002]
 Cysteine Peptidases
  Family C44
   BN194_22990 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2286387..2288291)
Genome map
AA seq 634 aa AA seqDB search
MCGIIAFADKTILNKKPVINNMMDMIKHRGPNSSGEYINDNVALGFRRLSIIDLKGGSQP
ILNEDGTVAIIFNGEIYNFQSIRKDLIAAGHVFKTHSDTEVLLHGYEEYGMDELLKKIRG
MFAFLIWDDNKKEMFGARDFFGIKPMYYYHDGDTFIVGSEIKAFLKHPKFKKQLNKEALK
PYLTFQYSALDETFFKGVYRIPEGHYFTLKDNKLTIKKYWDMDFKANNLSFEDTVAAIDK
SVSESVDAHRISDVEVGSLLSSGVDSSYITALLRPEHTFSIGFDNKKYHEGVAAKELSDK
LGLDNTSDIVTEKEALDNFPLIQYHLDEPDSNPSCVPLYFLTKLAHKDVTVILSGEGADE
LFAGYANYGFHTRSHAIRVFADGLRKLPKGVKYTIAHGLKKMPNFHGRLHLYESTAPAEE
FFIGEALVFHEGQADKILQPEFRQSESVRDIVTASYKKVRHYDDEVKKMQYLDIHQFMPK
DILLKADKLSMANSMELRVPFLDKEVAKVAAGIPTKYLINSHNSKYALREAANRHLPEEW
ASREKLGFPVPVKQWLEDEPFYKTVRKMFEQDWVKEFFDQDAILDILDRTYRQESDDRRK
VWTIYTFLVWYKVYFIDDEVPHYIADSSKEKLEA
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcatcgcgtttgcggacaagacaattttaaataaaaagccagttattaat
aacatgatggacatgatcaaacaccggggtcccaattccagcggcgaatatatcaatgat
aacgttgccctcggattccgccggttgtcgatcattgacttaaaaggtggttcgcagccg
atcctgaatgaggatggcacagttgcgatcatctttaatggggaaatttataacttccag
agcattcgcaaggatttgattgctgctggtcatgtgttcaagacccattccgataccgag
gttctacttcacggttatgaggaatatgggatggacgaacttctcaagaagattcgcggg
atgttcgccttccttatctgggatgacaataagaaggaaatgtttggcgcgcgtgatttc
tttggaatcaagccaatgtattactatcacgatggcgatacctttattgtgggtagtgaa
atcaaagcatttttgaagcatcctaagtttaagaaacaattgaacaaggaagcactgaag
ccttatttgactttccaatattcggctttggatgagactttctttaaaggggtttaccgg
attcctgaagggcactattttaccttgaaggataacaagttaaccattaagaagtattgg
gacatggatttcaaggcgaacaatttgagctttgaagatactgttgcagctattgacaag
agtgtttctgagtcagttgatgctcaccggatttccgatgtcgaagtcgggtctttactt
tcatcaggggtcgattcctcttatatcaccgccttgttgcggccagagcataccttctca
attggttttgacaacaaaaagtatcacgaaggcgttgccgctaaggaactcagtgacaaa
ctcggtttggataacactagtgatattgttactgaaaaagaagcgttagataacttcccg
ttgattcaatatcatttggatgaaccggattccaatccttcctgtgtaccgctatacttc
ctaacgaaactggcacacaaagacgtgaccgttattttgtctggggaaggtgctgatgaa
ctctttgctggttatgcgaactatggcttccatacgcgcagccacgccattcgagtcttt
gcggacggtttacgcaagttgccaaaaggtgttaagtatacgatcgcccatggcctgaaa
aagatgccgaatttccatggccgcttgcatctttatgaatcaacagcccctgccgaagaa
ttcttcatcggcgaagcactggtttttcatgagggccaggctgacaagatcttacaaccg
gaatttcggcaaagtgagagtgttcgtgacatcgtgaccgcttcgtacaaaaaggtacgt
cattacgatgatgaagttaagaagatgcagtatctcgacatccaccagttcatgccaaaa
gatattcttttgaaagctgacaagttgtcgatggccaactcgatggaattgcgggtaccg
ttccttgataaggaagtggctaaggtcgcggctggtatcccaaccaagtatctgatcaat
tcgcacaactcgaagtatgcattgcgtgaagctgctaaccgtcacttaccggaagaatgg
gcgagtcgtgaaaagctcggtttcccagtgccggtcaagcagtggttggaagacgaaccg
ttctacaagacggtccgcaaaatgtttgaacaagactgggtcaaggaattcttcgatcag
gatgccattctcgatatcttggatcgtacgtatcggcaggaaagcgatgatcgtcggaaa
gtttggacgatttacaccttccttgtttggtacaaggtctatttcatcgatgatgaagtg
ccgcattatattgcagattcaagtaaagagaaacttgaagcataa

DBGET integrated database retrieval system