KEGG   Lactobacillus casei W56: BN194_23970Help
Entry
BN194_23970       CDS       T02337                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lcw  Lactobacillus casei W56
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lcw03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2392626..2393264)
Genome map
AA seq 212 aa AA seqDB search
MITQYVFTTRGDTMQYPEPISKLIDSYMRLPGIGAKTATRLAFYTIDMNKDDVTAFAKSL
VAAKEDLHYCSICGNITDEDPCAICRDKSRDQSTILVVEQPKDVMSIDRAQDYHGLYHVL
HGVLSPIEGRGPEDLNIESLLKRLKANKAVKEVIIATNATPEGEATAQYLARLIKPAGIK
VTRLAHGLSVGSDIEYADEMTLMKAVEGRTEL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atcatcactcagtacgttttcacaacaagaggggacactatgcaatatccagaaccgatc
agtaaattgatcgacagttatatgcgcctcccgggtatcggggcaaaaaccgcgacacgg
ctggctttttacaccattgatatgaataaggacgatgtgacggcgttcgctaaaagtctt
gtcgcggcaaaagaggatctgcattattgttccatttgtggcaacattaccgatgaggat
ccgtgtgctatttgtcgcgataaaagtcgcgaccaaagcacgatattggtcgttgaacaa
cctaaagacgtcatgagcattgatcgggctcaggattatcatggcttgtatcatgtatta
catggcgttttatcaccaatcgaaggccgcggtcctgaagatctgaatattgagagtttg
ttaaaacggcttaaggcaaataaggcagtcaaagaagtcattatcgccactaatgccacg
cctgaaggtgaagccaccgcccaatacctggctcggctgattaaaccagctggtattaag
gtcactcgcttagcccatgggctgtcggtcggcagtgatattgagtatgctgatgaaatg
accttgatgaaggcggttgaaggaaggactgagctgtaa

DBGET integrated database retrieval system