KEGG   Lactobacillus casei W56: BN194_24470Help
Entry
BN194_24470       CDS       T02337                                 

Gene name
gltX
Definition
glutamate--tRNA ligase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lcw  Lactobacillus casei W56
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcw00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN194_24470 (gltX)
Enzymes [BR:lcw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     BN194_24470 (gltX)
Amino acid related enzymes [BR:lcw01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BN194_24470 (gltX)
Transfer RNA biogenesis [BR:lcw03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BN194_24470 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2447608..2449134)
Genome map
AA seq 508 aa AA seqDB search
MHVYRKMEAKTLADRPIRVRYAPSPTGHLHIGNARTALFNYLFARHNNGTLVLRIEDTDT
KRNVADGEKSQMENLHWLGIDWDEGPDKGGDFGPYRQSERKDIYDKLIKQLVDKGFAYES
YRTEEELKADREAQKARHEMPHYEYEYEGMTDAEKADAIAAAKAKGLEPVIRFHIPMDKT
YEWDDIVKGKISIDANTLGGDFVIQKRDGMPTYNFAVVVDDHMMQISHVLRGDDHIANTP
KQLAIYDAFGWEPPIFGHMTLIINGATGKKLSKRDETVLQFIEQYRELGYLPDAMFNFIT
LLGWSPVGEDEIFTKKEFIKQFDPKRLSKSPARFDQKKLEWVNNQYIKAKQKTNPNELMS
LSLANLIEDGKIHSDPDPKTIEWARQLISLYTDQMSYTAQISKLADIFFDKATDLTDDER
KELADDNAKPVIEAFAKKIRALDTFDAYSIGGIVNEVKQETKVKGRKLYMPIRIAATLRM
HGPQLAETIELMGRDQVLKNVDLVTGQL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtgcatgtttacagaaaaatggaggctaagacattggcagatcgaccaattcgggtgcgt
tatgcaccaagtccgaccgggcatttgcatatcggcaatgcgcggacggcgttgttcaat
tatttgttcgcacggcacaacaacggaacgttggtgctgcggatcgaagacaccgataca
aagcggaatgttgcagacggcgaaaagagtcagatggagaaccttcactggctcgggatt
gactgggatgaaggccccgacaaaggcggcgactttggcccataccggcagtctgaacgt
aaggacatctatgacaagctgatcaagcaacttgttgataaaggctttgcctacgagtct
tatcggaccgaagaggaactgaaagccgatcgggaagcccaaaaggctcgtcacgagatg
ccgcattacgaatatgaatatgagggcatgacggacgctgaaaaggctgacgcgattgcc
gcggccaaagcgaagggcttggagcctgtgattcggttccacattccaatggacaagacc
tacgagtgggacgacatcgttaaggggaaaatctcgattgatgccaacacactgggcggc
gattttgtcattcagaagcgtgatggcatgccaacgtacaattttgcggtggtagtagac
gatcatatgatgcaaatcagccacgtgttgcgtggggacgatcatattgccaacacacca
aagcaattggccatttacgatgcatttggctgggaaccaccaatttttggtcatatgacc
ttgatcatcaatggcgccaccggtaagaagttgtctaagcgtgatgaaaccgtgttacag
ttcattgaacaatatcgtgaactcggctacttgccagacgcgatgttcaacttcattacg
ctccttggctggtccccagttggtgaagatgaaattttcaccaaaaaggaattcatcaag
caattcgatccaaagcggctatctaagagcccagcccgttttgaccagaagaaattggaa
tgggtgaacaaccaatacatcaaggccaagcaaaagacgaacccgaatgaattgatgagt
ttgtccttagctaacttgattgaagatggcaaaattcatagtgatccagatccgaagacc
atcgagtgggcgcgccagcttattagtctttacaccgatcaaatgagttatactgctcag
atcagcaaacttgccgatattttcttcgacaaagccactgacctaaccgatgacgaacgc
aaagaactggcagatgacaatgctaagccagtcatcgaagccttcgccaaaaagattcgg
gcactcgacacgtttgacgcttattccattggcggtattgtcaatgaagtcaagcaggaa
accaaggtcaagggtcgcaagctttacatgccaattcgaatcgctgcaacattgcggatg
catggtccgcaacttgctgaaaccattgaactgatgggccgcgatcaagtccttaaaaac
gttgatcttgtcaccggccaactttaa

DBGET integrated database retrieval system