KEGG   Lactobacillus casei W56: BN194_27000Help
Entry
BN194_27000       CDS       T02337                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lcw  Lactobacillus casei W56
Pathway
lcw00900  Terpenoid backbone biosynthesis
lcw01100  Metabolic pathways
lcw01110  Biosynthesis of secondary metabolites
lcw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lcw00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN194_27000 (ispE)
Enzymes [BR:lcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BN194_27000 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: CCK23647
UniProt: K0N8F2
Position
complement(2707129..2708103)
Genome map
AA seq 324 aa AA seqDB search
MLKITIRSMHTTGLAVIVIDRQAYGSPETGGWMELIEKAPAKINLSLDALYRHDDGEHEW
QMVMTSVDLADYVMISPHRSIQVSTDSGFLPEDPRNLAYKAALALQRHANIRQGARIHIE
KHIPVAAGLGGGSSDAAAVLRGLNSLWQLGYSRSQLARIGLSVDSDVPYCVYSETALVTG
RGDVVTPLGSLPNFWVVLAKPRVSVSTPTILNAIDYDAGLRHPDTQTVVAGIQNHDFAQM
TSGMANSLEAITASRYPEMTALKQRLQKYGAEFAQMSGSGPTVFGLCQKHSRAMRVYNSM
KGFCREVYLLRPFCLSATGPRFRG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atactaaaaataactatacggtcgatgcatacaacggggcttgcggtgatagtgattgac
cggcaagcgtatgggtcgccagagactggtggttggatggaactgatcgaaaaagcaccg
gccaagattaatctcagcttggatgccttgtatcgccatgacgacggcgaacatgagtgg
cagatggtcatgacatcggtcgatttagctgactatgtgatgattagcccgcatcgcagc
attcaggtttcgacagatagcggcttcctacctgaagatccgcgcaatctggcctacaaa
gcagcgttggcgctgcagcgtcacgccaatatccgtcaaggtgcgcggattcatattgaa
aaacatattccggtcgccgcggggcttggcggcggctcaagtgatgcagctgccgttttg
cgagggttgaattcgctttggcaactcggttatagtcggtcacaattagcacggatcggc
ttaagtgttgatagtgatgtcccttactgtgtttattcagagacggcgctcgtaactggt
cgcggtgatgtggttaccccacttggcagcttgccgaatttttgggtcgtgttggcaaag
cctcgcgtttcagtatcgacgccgaccattttgaatgccattgattatgacgccggtctg
cgccatcctgatacgcaaacggtggtggcaggcattcaaaatcatgactttgcacaaatg
acgagtggcatggcgaatagccttgaagccatcactgctagtcggtatccggaaatgacc
gccctcaagcagcggctacaaaagtatggtgccgaattcgcgcaaatgtcaggcagcggc
ccaacagtttttggtctgtgccaaaagcactccagagccatgcgggtttataacagcatg
aagggcttttgccgcgaagtttacctattacggccattttgcttatccgccacgggtcca
cggtttaggggttga

DBGET integrated database retrieval system