KEGG   Lactobacillus casei W56: BN194_27820Help
Entry
BN194_27820       CDS       T02337                                 

Gene name
gmuD
Definition
6-phospho-beta-glucosidase gmuD (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lcw  Lactobacillus casei W56
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lcw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN194_27820 (gmuD)
Enzymes [BR:lcw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BN194_27820 (gmuD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2787087..2788517)
Genome map
AA seq 476 aa AA seqDB search
MTIQFDADFVWGAATSGPQAEGTFHKKHENIFDYHYHTRPQDFYHNVGPDVASNFYNDYE
NDLALLKQAGVQALRISIQWTRLIDDLEAGTVDPVGADYYRRVFKTMHQLGITPYVNLHH
FDLPVTLQHQYGGWQSKHVVDLYVKFATRCFELYSDQVTHWFTFNEPKVIVDGQYLYQFH
YPNIVDGRLAVQAAYNLNLASAKAVAAFRQINRQSQGTIGTIVNLTPVYPASQAPEDLAA
ARFAEQWANDLYLEPAIHGRFPEELVARLKRDGVLWEATSDELAVIAANRIDVLGVNYYH
PFRVQAPAVSPDSLQAWLPDIYFDNYDMPGRKMNLDKGWEIYPDALYDIAMTIKRRYDNL
PWFVAENGIGVANEERFLKDGMVQDDYRIQFMTDHLRFLSQAITEGANCHGYFVWTGIDC
WSWLNAYKNRYGLIRNDLCNQTKSLKKSGHWFSQVAATGLVAPTLRPFESEEKNHG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaccattcaatttgatgctgactttgtctggggagcggcaaccagcggtccgcaggca
gaaggcacttttcataaaaagcacgaaaacatttttgattatcattaccatactcggcca
caagacttctaccacaacgttggtccggatgttgcctcgaacttctacaacgattatgaa
aacgatcttgctttgttgaagcaagcaggcgtgcaggcattacgaatctcgattcagtgg
acacgcctgattgacgatcttgaagcaggcacggtggatccagtaggggccgattattat
cgccgagtttttaagactatgcatcaacttggtatcacgccgtatgtgaatctgcatcat
tttgacttgccagtgacgttacaacatcaatatggcggctggcagtcaaagcatgtggtg
gatctctatgtgaaatttgccacgcgttgttttgaactgtatagcgaccaggtgacgcat
tggttcacctttaatgaacctaaagtcatcgttgacggccaatacttatatcagtttcac
tatcctaatattgtcgatgggcggctggctgtgcaagctgcgtacaacctgaacttagct
agtgccaaagctgtggcggcgtttcggcagatcaatcggcagtcgcaaggaacgattggc
acaattgttaatctgacaccggtttatccggcctcgcaggcacctgaggacttggctgca
gcgcgatttgcggaacagtgggcgaatgatctttatttagagccagctattcatgggcgt
tttccagaagagctggtagcacgactcaaacgagatggcgttttatgggaggcaacctca
gacgaattggcggtgatcgctgccaaccggattgatgtacttggggttaactactaccat
ccgttccgggtgcaagccccggctgtttcaccagatagcttacaagcgtggttgcctgac
atatattttgacaattacgacatgccaggccgaaaaatgaatttggataaaggctgggaa
atatacccagacgcattatatgacattgcaatgaccattaagcgtcgctacgacaatctg
ccttggtttgtggctgaaaatggtataggggtagcaaacgaagaacggtttttgaaagac
ggtatggtccaagacgattatcgcattcagtttatgaccgatcacctgcgattcttaagc
caggctatcacagaaggggctaattgtcatggctacttcgtgtggaccggcattgactgc
tggtcatggctgaatgcttacaagaatcggtacggtttgattcgtaatgacctatgcaat
caaacaaagtcactcaaaaaatcaggtcactggtttagtcaggtggcggcgactggattg
gtggcgccaacgttgcgtccatttgaaagtgaggaaaagaatcatggctga

DBGET integrated database retrieval system