KEGG   Lactobacillus casei Zhang: LCAZH_0084Help
Entry
LCAZH_0084        CDS       T01280                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lcz  Lactobacillus casei Zhang
Pathway
lcz00260  Glycine, serine and threonine metabolism
lcz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lcz01100  Metabolic pathways
lcz01110  Biosynthesis of secondary metabolites
lcz01130  Biosynthesis of antibiotics
lcz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCAZH_0084
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LCAZH_0084
Enzymes [BR:lcz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LCAZH_0084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB PucR DUF5414
Motif
Other DBs
NCBI-ProteinID: ADK17382
Position
complement(75792..76586)
Genome map
AA seq 264 aa AA seqDB search
MSKLADVFKKHKVFIPFIVADDPDFETTVKNVVALAKGGADIVELGIPFSDPVADGPVIQ
AADLRAFAANVRTKTVFDIVEAARKETTVPIVFLTYLNIVFKYGYEAFLKRCADLNVAGL
VIPDLPYESRDEIVPIAEKYGIDIIPLITPTSGHRIEKIAKRASGFIYVVSSMGITGERD
EFFAGLKALVTEIKQYTNVPTAIGFGIHTPEQAQTMAGIADGVIIGSAIVDLVAKEKQQA
PAAIEKFTKQIRVAVDAKKQVSVK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagttagcagatgtttttaaaaagcataaagtctttatccccttcatcgtcgcc
gatgatcctgattttgaaaccaccgtcaaaaacgtggtcgcacttgccaaaggtggcgcc
gatatcgtggaattaggcattcctttttccgatccagtcgctgatggtccagtgattcaa
gccgccgacctaagagcgttcgcggccaacgttcgcaccaaaacggtctttgacattgtt
gaagccgcccgcaaagaaaccacggtgccaatcgtcttcctgacttacttgaacattgtc
ttcaaatacggctacgaagccttcttaaaacgctgtgcggatttaaatgtcgccggcttg
gtgatcccagatctgccgtatgaaagtcgcgatgaaattgtgccaattgccgaaaaatac
ggtatcgatattattccgttaatcacgccaacttccggtcatcgaattgaaaaaattgcc
aaaagggcctcaggatttatctatgtcgtttcatcaatgggcattactggcgaacgcgat
gaattctttgctggcttaaaggcattagtcacagaaattaagcagtataccaatgttcca
accgctatcggctttggcattcacacgcctgaacaagcgcaaacaatggcaggcatcgcc
gatggtgtcatcatcggcagcgccatcgttgatcttgtcgcgaaggaaaaacaacaggca
ccggctgcgattgaaaagtttactaagcagatccgggtagccgttgatgctaaaaagcaa
gtttcggtgaaataa

DBGET integrated database retrieval system