KEGG   Lactobacillus casei Zhang: LCAZH_0084Help
Entry
LCAZH_0084        CDS       T01280                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LCAZH_0084
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCAZH_0084
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LCAZH_0084
Enzymes [BR:lcz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LCAZH_0084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(75792..76586)
Genome map
AA seq 264 aa AA seqDB search
MSKLADVFKKHKVFIPFIVADDPDFETTVKNVVALAKGGADIVELGIPFSDPVADGPVIQ
AADLRAFAANVRTKTVFDIVEAARKETTVPIVFLTYLNIVFKYGYEAFLKRCADLNVAGL
VIPDLPYESRDEIVPIAEKYGIDIIPLITPTSGHRIEKIAKRASGFIYVVSSMGITGERD
EFFAGLKALVTEIKQYTNVPTAIGFGIHTPEQAQTMAGIADGVIIGSAIVDLVAKEKQQA
PAAIEKFTKQIRVAVDAKKQVSVK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagttagcagatgtttttaaaaagcataaagtctttatccccttcatcgtcgcc
gatgatcctgattttgaaaccaccgtcaaaaacgtggtcgcacttgccaaaggtggcgcc
gatatcgtggaattaggcattcctttttccgatccagtcgctgatggtccagtgattcaa
gccgccgacctaagagcgttcgcggccaacgttcgcaccaaaacggtctttgacattgtt
gaagccgcccgcaaagaaaccacggtgccaatcgtcttcctgacttacttgaacattgtc
ttcaaatacggctacgaagccttcttaaaacgctgtgcggatttaaatgtcgccggcttg
gtgatcccagatctgccgtatgaaagtcgcgatgaaattgtgccaattgccgaaaaatac
ggtatcgatattattccgttaatcacgccaacttccggtcatcgaattgaaaaaattgcc
aaaagggcctcaggatttatctatgtcgtttcatcaatgggcattactggcgaacgcgat
gaattctttgctggcttaaaggcattagtcacagaaattaagcagtataccaatgttcca
accgctatcggctttggcattcacacgcctgaacaagcgcaaacaatggcaggcatcgcc
gatggtgtcatcatcggcagcgccatcgttgatcttgtcgcgaaggaaaaacaacaggca
ccggctgcgattgaaaagtttactaagcagatccgggtagccgttgatgctaaaaagcaa
gtttcggtgaaataa

DBGET integrated database retrieval system