KEGG   Lactobacillus casei Zhang: LCAZH_0084Help
Entry
LCAZH_0084        CDS       T01280                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lcz01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lcz00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lcz00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(75792..76586)
Genome map
AA seq 264 aa AA seqDB search
MSKLADVFKKHKVFIPFIVADDPDFETTVKNVVALAKGGADIVELGIPFSDPVADGPVIQ
AADLRAFAANVRTKTVFDIVEAARKETTVPIVFLTYLNIVFKYGYEAFLKRCADLNVAGL
VIPDLPYESRDEIVPIAEKYGIDIIPLITPTSGHRIEKIAKRASGFIYVVSSMGITGERD
EFFAGLKALVTEIKQYTNVPTAIGFGIHTPEQAQTMAGIADGVIIGSAIVDLVAKEKQQA
PAAIEKFTKQIRVAVDAKKQVSVK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagttagcagatgtttttaaaaagcataaagtctttatccccttcatcgtcgcc
gatgatcctgattttgaaaccaccgtcaaaaacgtggtcgcacttgccaaaggtggcgcc
gatatcgtggaattaggcattcctttttccgatccagtcgctgatggtccagtgattcaa
gccgccgacctaagagcgttcgcggccaacgttcgcaccaaaacggtctttgacattgtt
gaagccgcccgcaaagaaaccacggtgccaatcgtcttcctgacttacttgaacattgtc
ttcaaatacggctacgaagccttcttaaaacgctgtgcggatttaaatgtcgccggcttg
gtgatcccagatctgccgtatgaaagtcgcgatgaaattgtgccaattgccgaaaaatac
ggtatcgatattattccgttaatcacgccaacttccggtcatcgaattgaaaaaattgcc
aaaagggcctcaggatttatctatgtcgtttcatcaatgggcattactggcgaacgcgat
gaattctttgctggcttaaaggcattagtcacagaaattaagcagtataccaatgttcca
accgctatcggctttggcattcacacgcctgaacaagcgcaaacaatggcaggcatcgcc
gatggtgtcatcatcggcagcgccatcgttgatcttgtcgcgaaggaaaaacaacaggca
ccggctgcgattgaaaagtttactaagcagatccgggtagccgttgatgctaaaaagcaa
gtttcggtgaaataa

DBGET integrated database retrieval system