KEGG   Lactobacillus casei Zhang: LCAZH_0085Help
Entry
LCAZH_0085        CDS       T01280                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LCAZH_0085
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCAZH_0085
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LCAZH_0085
Enzymes [BR:lcz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LCAZH_0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(76579..77709)
Genome map
AA seq 376 aa AA seqDB search
MTELEKVTKAFNDLKDNPEFKAELNDLLVNYANRPSLLYYAKNMTEDLGGAKIYLKREDL
NHTGAHKINNVIGQALLAKHLGKKRLIAETGAGQHGVATATIAALMGMDCEIFMGKEDTD
RQKLNVYRMELLGAKVHPVTSGSMVLKDAVNATLQEWASRSDDTFYVLGSAVGPAPFPEM
VKHFQSVISTESKQQLQAKEARLPDMVVACVGGGSNAIGSFAAYIDDPSVQLVGVEAAGK
GVDTDRTAATIERGSVGIFHGMKSLFMQNEDGQIDPVYSISAGLDYPGVGPEHAALAQEG
RAQYVGITDDEAVEAFTYIAKQEGIVAAIESCHAIAYVEKIAPQMAKDQIIICTLSGRGD
KDVASIAKYKGVDVDE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcttgaaaaagtcactaaggcttttaatgacttaaaagataatcctgaattc
aaagcagaattaaatgatctattggttaattacgccaatcgcccctcgttgctttattat
gccaagaacatgaccgaagaccttggtggcgccaaaatctacttaaaacgagaagatcta
aatcataccggtgcacataagatcaataatgtcatcggtcaggccttgcttgccaaacat
ttaggcaaaaagcgcctgattgctgaaaccggtgccggtcaacatggtgtcgctaccgcc
accattgccgcactcatggggatggactgtgaaattttcatgggtaaagaagacactgac
cgtcaaaagttaaacgtttatcgcatggaacttctcggcgcaaaggttcatccagtcaca
agcggatcaatggttttaaaagacgcggttaacgccacactgcaagaatgggcgagtcgc
agtgatgacactttctacgtgttaggttctgcagtcggcccggcgccgttccccgaaatg
gtgaaacattttcaaagtgtcatttcaacggaatcgaaacagcaacttcaggccaaagaa
gctcggctgccagacatggtcgttgcctgtgtaggtggtggcagtaacgccattggaagt
tttgccgcttatattgatgatccttctgttcaattagtcggcgttgaagcagccggtaaa
ggcgttgataccgacagaaccgccgcaaccatcgaacgcggctccgttggcattttccac
ggcatgaagtccttattcatgcaaaatgaagacggccagattgatccggtatattccatt
tctgccggccttgattaccccggcgttggccccgagcatgccgctctcgctcaggaaggc
cgggcgcaatacgttggcattaccgacgacgaagcagttgaagcctttacctacattgcg
aaacaagaaggcattgttgccgccattgaaagctgtcacgccatcgcctacgttgaaaag
attgccccacagatggcaaaagatcaaatcattatctgtaccttgtccggacgtggcgat
aaggacgtcgcaagcattgccaaatacaaaggagtcgatgttgatgagtaa

DBGET integrated database retrieval system