KEGG   Lactobacillus casei Zhang: LCAZH_0247Help
Entry
LCAZH_0247        CDS       T01280                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LCAZH_0247
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LCAZH_0247
Enzymes [BR:lcz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     LCAZH_0247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
236559..238112
Genome map
AA seq 517 aa AA seqDB search
MALSLRACILLLKEHHLLKSAAIQNTEDVDMTGIAYDSRKVSGPTLFFCKGDKFRPIYLS
MAKDNGARTYVAEKPYVEGNGLNALIVRNITKAMAILSAAFFDYPQDDLFVIAYTGTKGK
TTASYFTEAILNEARPRHIALFSTIDTVVGPEPDQRFKSNLTTPESLDLFRDMREAVENG
MTHLVMEVSSQAYLRNRVFGLTYDVGFFLNITPDHIGPNEHPTFANYLHNKLQLLVNARK
VVINAETEHFDQVYAAATTTTYPESIYLFASAGFRPKRDDIDIDFRFDSQEADVAESRFT
LVPVTEKAAALNIGGHYSLALIGDFNESNATAAIIGAGLAGVDASAAVPGIAKVKIPGRM
EHTKVAGHGAVYVDYAHNYASMKALLSFLKHAYKDPRLLVVVGSPGDKGVSRRPGFAKVL
TEFATEAFLTTDDPGYEDPANIIEEIDSKIDHSKVKVHKVLDRQRAIAEAISDSRPNDIV
VVAGKGADPYQKVRGVNTPWPTDMAVVKQVAKSLQEG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcactatcacttagagcatgtatcttattattaaaggaacatcatctgctaaagagt
gcagcaattcagaatactgaagatgtcgatatgaccggcatcgcctatgattcacgcaag
gtctctggaccaacgctgtttttctgcaaaggcgataagttccgaccaatttatctttcc
atggccaaggacaacggtgcgcgaacttatgttgccgagaaaccttacgttgaaggcaac
ggcttaaacgccttgatcgtgcggaatattactaaagcaatggcgattttgagcgctgct
ttctttgattatccgcaagatgatttgtttgtgatcgcttatacaggaaccaaggggaaa
accacagcttcctattttacagaagctattttaaatgaggctcgtccacgacacatcgcg
cttttttctacaattgatacggttgttggtcctgagcccgatcagcgtttcaagtctaat
ctgacaacgccagagagcctcgatcttttccgcgatatgcgcgaggctgtcgaaaacggt
atgacccatctcgtgatggaagtgtcgagtcaggcatatttgcgcaatcgcgtttttgga
ttgacgtatgacgtcggcttcttcctgaacattacgccagatcacatcggaccgaatgaa
catccaacctttgctaattacttacacaacaagctgcaattgttggtcaatgcgcgcaaa
gtggtcattaatgccgaaaccgagcattttgaccaggtttatgctgccgcaacgaccacc
acttatccagaaagtatctacctgtttgccagtgctggcttcagacctaaacgcgatgat
atcgatattgattttcgctttgatagtcaggaagctgacgttgctgagagtcgtttcact
ttagtaccagtcacggaaaaagcagcagcattgaacatcggcggtcactactcgcttgct
ttgattggtgattttaacgaaagtaacgcgacggctgctattattggtgctggattggct
ggtgtggatgcatctgccgctgttcccggtattgcaaaagttaaaatccccggtcgcatg
gagcatacgaaagttgccggacatggtgctgtctatgttgattatgcgcacaattacgct
agtatgaaggcgttattgtcgtttttgaaacacgcttacaaggatcctcgattactggtt
gtggttggatcccccggtgataaaggtgtttctcgtcgtcccggatttgctaaggttctc
actgagtttgcaactgaggcattcttgactaccgacgatcctgggtacgaagatccagca
aacatcattgaggaaatcgatagtaaaatcgatcatagcaaagttaaagtacacaaagtg
cttgatcggcaaagggccattgctgaagctattagcgacagcagaccaaatgatatcgtg
gtggtggctggcaaaggggccgacccctatcaaaaggtacgcggcgtcaacacaccatgg
ccaacagacatggctgttgtaaagcaagtcgctaaatcgctacaggaaggctga

DBGET integrated database retrieval system