KEGG   Lactobacillus casei Zhang: LCAZH_0318Help
Entry
LCAZH_0318        CDS       T01280                                 

Definition
glycosyl hydrolase, family 35
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LCAZH_0318
Enzymes [BR:lcz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LCAZH_0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
314671..316467
Genome map
AA seq 598 aa AA seqDB search
MTTFSIDHEFMLDGQPFKILSGAIHYFRVHPSDWYHSLYNLKALGFNTVETYVPWNLHEY
NEGDFDFSGILDIERFLNTAKDLGLYAIVRPSPYICAEWEFGGFPAWLLTKKMRLRTDDS
AYLQAIDRYYTALMPHLVGHQVTHGGNVIMMQVENEYGSYGEDKDYLAAVAELMKKHGVD
VPLFTSDGPWPATLNAGSMADAGILTTGNFGSRADMNFDRLAAFNQAHGHDWPLMCMEFW
DGWFNRWGEPIIRRDPEETAEDLRAVIQRGSVNLYMFHGGTNFGFMNGTSARKDHDLPQV
TSYDYDAPLNEQGNPTPKYFAIQKMIHEVLPSQAQTTPLVKPAMTQADNPLTAKVSLFSV
LDQLAQPVAAPYPQTQEFLGQYTGYTLYRTNPLISGTDKGTPAKLRVIDARDRVQAFFDG
KSLATQYQEAIGDDILLPEVEGRHQLDLLVENMSRVNYGSKIEAITQFKGIRTGVMVDLH
FIKDYLQYPLDLNKAPQLDFTGDWQAGTPAFYQYGFDVVKPQDTYLDCRGFGKGVMLVNG
VNIGRFWEKGPTLSLYVPAGLLHTGHNEVIVFETEGQYAEAINLVDHPIFKELNTEEE
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccttttcgatcgatcatgagtttatgttggacggtcagccgttcaagattctg
tctggcgcgattcattacttccgagtccatcccagtgattggtatcacagcctttataac
ttgaaggcactgggatttaacacggtagaaacctatgtcccttggaatctgcacgagtac
aacgaaggtgactttgatttcagcgggattctcgacattgaacgctttctaaacaccgca
aaggatcttggcttatacgccatcgttcgaccatccccttacatctgcgcagaatgggag
ttcggcgggtttccagcatggctgttaacgaaaaagatgcgcttgcgaaccgacgattct
gcctatctgcaagcgattgaccgttactacacagctttaatgcctcatcttgtgggtcat
caagtcacgcatggtggcaatgtcatcatgatgcaagtggaaaatgagtacggttcatat
ggcgaagacaaggactatcttgccgccgtggccgaacttatgaaaaagcatggcgttgat
gtccccctttttacctcggatggtccctggccagcaaccttgaacgctggcagcatggcc
gacgctggtattttgactaccggcaattttggctcacgtgccgacatgaatttcgatcgg
ttggcggccttcaatcaagctcatgggcatgattggccgttgatgtgtatggaattttgg
gacggctggttcaaccgctggggcgaaccgatcattcgccgcgacccagaagaaactgcc
gaggacttgcgagcggtgatccaacgcggcagtgtcaatctctacatgttccacggggga
actaattttggttttatgaacggtacctcagctcgcaaagatcatgatctgccgcaagtg
acttcctacgattacgatgcaccattgaatgagcaaggcaatccaacgccaaagtacttt
gccattcagaaaatgatccacgaagtcttgccatcgcaggcccagacaacaccactggtc
aagccagcgatgacgcaggcggacaatccgttgacggcgaaagtgtcattattctcagta
cttgatcagctagctcagccagtagccgcaccttatccgcagacacaggagtttcttggc
caatacaccggttatacgttgtatcggacaaacccgctgatcagtggtaccgataaaggc
acgccggctaagttgcgcgtgattgatgcccgtgatcgggttcaagccttctttgatggc
aagtcgctagcaacacagtatcaagaggccatcggcgatgacatcctgctcccagaagtt
gaaggccgccatcaactagatctgttggtcgaaaacatgagccgcgtcaactatggctca
aaaatcgaagcgattacccagtttaaggggattcgcaccggtgtcatggtagacctccat
ttcattaaggactacctgcaatacccacttgacttgaacaaggcgccgcaacttgatttc
accggcgattggcaagcagggacacccgctttttatcaatatgggtttgatgtggtgaaa
ccacaggatacgtatcttgattgtcgtggattcggtaaaggagtgatgctggtcaatggt
gttaacatcggcagattctgggagaaggggccaacgttgtcactatatgtgccagccggg
ttgcttcacaccgggcacaatgaggtcattgtttttgaaaccgaaggccaatatgccgag
gcgataaacttggttgaccacccaatatttaaggaactgaacacagaggaggaataa

DBGET integrated database retrieval system