KEGG   Lactobacillus casei Zhang: LCAZH_0359Help
Entry
LCAZH_0359        CDS       T01280                                 

Definition
sugar kinase, ribokinase family
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LCAZH_0359
Enzymes [BR:lcz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LCAZH_0359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
354781..355710
Genome map
AA seq 309 aa AA seqDB search
MPNHVVVIGSINVDSILHIQRLPQPGETIKMDTFSQAAGGKGANQAVAAARSGAKTSFIG
RVGDDANAAFMRGELVKNQIDTQYVATTVGTQTGQAYILLQASGQNSIIIQHGANFEVTP
ADVQRAADLIQSADFVVAEFETPVDATAEAFKIAKAAGKMTILNPAPAQKDLPAALLKNV
DLIAPNETESELITGIPVVDEDSMRASAAYYHELGIRGVIITLGSKGSFISLDGEATIVP
AFKVKAVDTTAAGDTFIGALASVLQTDLKNIVTAATYASMASSFTVQKLGAFPSIPMGDE
VRAALAKIK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatcatgttgttgtcatcggcagtatcaatgtggatagcatcttgcacattcaa
cggttgccacaaccgggagaaacgatcaaaatggacaccttttcgcaagcggctggcggt
aaaggggcgaatcaagcagttgcggctgcgcgttcgggggccaaaaccagttttattggc
cgagttggtgacgatgccaacgctgccttcatgcgcggtgaacttgtcaagaaccaaatc
gacacccaatatgtggcgacaacggttggcacgcaaaccggtcaggcttacattttgctg
caagcctctggccaaaattccattatcatccagcatggcgctaattttgaggtgacacca
gcagatgtgcaacgagcagccgacttgattcagtctgccgactttgtggtcgcggaattt
gaaacgccggtggatgcgacggcagaggccttcaaaattgccaaagctgctgggaagatg
accatcttaaacccagcgccggcacagaaggatttgccagcagctttgctgaaaaatgtg
gatctcatcgcaccgaacgaaaccgaaagcgagctgatcaccggcattccggtggtagat
gaagacagcatgcgggcttcggcagcttattatcatgaattaggcattcgcggggtgatc
atcactttaggatcaaaaggctccttcatctcgctggatggcgaagcaaccatcgtgcca
gcctttaaagtcaaggctgtcgacaccaccgcggccggcgacactttcattggcgccttg
gccagcgttttacagacagatctcaaaaacatcgtcacggctgcgacatacgcaagcatg
gcgagctccttcacagtccaaaaactcggcgccttcccgtccattccgatgggggatgag
gtgcgggcggcgttagcgaaaatcaagtga

DBGET integrated database retrieval system