KEGG   Lactobacillus casei Zhang: LCAZH_0391Help
Entry
LCAZH_0391        CDS       T01280                                 

Definition
sucrose phosphorylase-like protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LCAZH_0391
Enzymes [BR:lcz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LCAZH_0391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
384789..386213
Genome map
AA seq 474 aa AA seqDB search
MPMFPYTSDDGFSVTDYMAINPDLGDWQDVYALRQSKRLMFDFVANHMSANSLWFKRFMN
HDAGFEKAYIEFDPTFDTSKVIRPRVSPLFHTYQNDRGETKTVWTTFSEDQVDINFGDPL
MLARQTKVLLEYAKRGAASIRLDAIGFIWKESGTTCMHRPETHEIVRLWRTLLDHFAPNT
QIITETNVPNKENISYFGQGDDEAHQVYQFPLPPLVLYSFISGDADHLQEWAKTVQAPSS
KATFFNFLASHDGIGLRPVEGILSADERQRIIDRVLTNHGQVSYKDNPDGTKSVYELNIN
YGDALRISTDTDAEAANKMIAAHNILVSMVGVPAIYYHSMFGSKGDLKAVKETGMNRRIN
RERVDYDRLKNELRTDQYRQKVYAGISHLLKVRQKNIAFNPFGKQEVLELGKQIFAVKRF
SDDGSAIISFTNVSSQPATIHNIEGRELLSEKLVRNDLRLKPYGIAWLKMEASK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
ttgccaatgttcccatatacatcagatgatgggttttccgtcacagattacatggccatt
aatccggatcttggtgattggcaggacgtctatgcgctgcgacagtcaaagcggctgatg
ttcgattttgttgctaatcacatgtctgcaaacagtctttggtttaagcgttttatgaac
catgatgctggttttgaaaaggcgtatatcgaatttgatccaacttttgatacatcaaag
gtgattcggccgagagtttcgccactttttcatacttatcaaaatgatcgtggtgaaact
aagacggtttggacaaccttcagtgaagatcaagttgatattaattttggcgatccactc
atgttagctcgtcagacaaaggtgttgcttgaatatgcaaagcggggcgcggcctcgatt
cgcttggacgccattggttttatttggaaagaaagcggcactacttgcatgcatcgcccg
gagacccatgaaattgtccgactgtggcgaacactgcttgaccattttgcgccgaatact
cagatcattactgaaacaaatgtgccaaataaggaaaacatcagctattttggccagggt
gatgacgaagcgcaccaagtctatcaatttccgctaccgccattggttctttatagtttt
atttccggggatgctgatcatcttcaagagtgggctaaaactgtgcaggcaccatctagt
aaagccactttcttcaactttcttgcttcacatgatggtattgggttgcgaccagttgaa
ggcattttaagtgcggacgaaaggcaacgcatcattgaccgggttttaaccaaccatggg
caagtgtcgtacaaagataacccagacggcaccaagtctgtttatgagttgaatataaac
tatggcgatgctttaagaataagcactgatacggatgcagaagcggccaataagatgatc
gcggcacacaatatcctagtctcaatggtcggcgtaccagcgatctactaccactcaatg
tttggctctaaaggtgaccttaaggcggttaaagaaactggtatgaatcgccgcattaat
cgcgaaagagttgactatgatcggttgaagaatgagctacggacagatcagtatcgtcaa
aaagtttacgcaggaatcagtcatttactcaaagttcgtcaaaagaacatcgcctttaat
ccgtttggcaaacaagaagtattagaacttggaaagcagatttttgccgtgaagcggttt
agtgatgatggctcagcgattatttcatttacaaatgtttcaagtcagccagcaactatc
cacaacattgagggtcgagagctgctatcagagaagcttgtcaggaatgatttgcgactg
aagccatacggtattgcgtggttgaagatggaggcatcaaagtga

DBGET integrated database retrieval system