KEGG   Lactobacillus casei Zhang: LCAZH_0712Help
Entry
LCAZH_0712        CDS       T01280                                 

Definition
(GenBank) holliday junction resolvasome, DNA-binding subunit
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lcz  Lactobacillus casei Zhang
Pathway
lcz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LCAZH_0712
Enzymes [BR:lcz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LCAZH_0712
DNA repair and recombination proteins [BR:lcz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     LCAZH_0712
    RecFOR pathway proteins
     LCAZH_0712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH Transposase_20 IMS_HHH HHH_8
Motif
Other DBs
NCBI-ProteinID: ADK17997
Position
715479..716075
Genome map
AA seq 198 aa AA seqDB search
MYEYFEGIIQAVTPAYIVIDVHGIGFRLLVANPYHFEAGEQKRVYVQLIIRDNDQTLYGF
EGAADKRTFNQLLTVTGIGPKSALAILANVSSGGLATAIAQDDVKFLTKFPGIGKKTAAQ
IILDLKGKITTDGQPAAAAIAPVASDVDSELADALAALVALGYPQRTVDGLTDTLKAFSA
KTTDAYLREGLRLLSGKA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagtattttgaaggcattattcaggcggtgaccccggcttacatcgtcatcgat
gtgcatggcatcgggttccgtctgctggtagccaacccttatcattttgaagctggcgag
caaaaacgtgtttatgtgcagctgatcattcgcgacaacgaccagacactttatggattc
gaaggtgctgcggataagcgtacctttaaccagctattgacggtcacaggcattggcccg
aagtcagcgttggccattttggcgaacgtgtctagcggcggcttggcgactgcgattgct
caagatgatgtgaagtttttgactaagtttcctgggatcggtaagaaaacagctgcccag
attatcctcgatctcaaaggtaaaatcacaacagatggacaaccagcggcagcagcgatt
gcgccagttgccagtgacgttgattcggaacttgcagatgcgttagcggcactcgtggca
ttgggctacccgcaacgcaccgttgatggtctcactgacacactgaaggcattcagtgcc
aagacaactgatgcctatttacgcgaaggcttgcggctattaagcggcaaggcttag

DBGET integrated database retrieval system