KEGG   Lactobacillus casei Zhang: LCAZH_0712Help
Entry
LCAZH_0712        CDS       T01280                                 

Definition
holliday junction resolvasome, DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lcz03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
715480..716076
Genome map
AA seq 198 aa AA seqDB search
MYEYFEGIIQAVTPAYIVIDVHGIGFRLLVANPYHFEAGEQKRVYVQLIIRDNDQTLYGF
EGAADKRTFNQLLTVTGIGPKSALAILANVSSGGLATAIAQDDVKFLTKFPGIGKKTAAQ
IILDLKGKITTDGQPAAAAIAPVASDVDSELADALAALVALGYPQRTVDGLTDTLKAFSA
KTTDAYLREGLRLLSGKA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagtattttgaaggcattattcaggcggtgaccccggcttacatcgtcatcgat
gtgcatggcatcgggttccgtctgctggtagccaacccttatcattttgaagctggcgag
caaaaacgtgtttatgtgcagctgatcattcgcgacaacgaccagacactttatggattc
gaaggtgctgcggataagcgtacctttaaccagctattgacggtcacaggcattggcccg
aagtcagcgttggccattttggcgaacgtgtctagcggcggcttggcgactgcgattgct
caagatgatgtgaagtttttgactaagtttcctgggatcggtaagaaaacagctgcccag
attatcctcgatctcaaaggtaaaatcacaacagatggacaaccagcggcagcagcgatt
gcgccagttgccagtgacgttgattcggaacttgcagatgcgttagcggcactcgtggca
ttgggctacccgcaacgcaccgttgatggtctcactgacacactgaaggcattcagtgcc
aagacaactgatgcctatttacgcgaaggcttgcggctattaagcggcaaggcttag

DBGET integrated database retrieval system