KEGG   Lactobacillus casei Zhang: LCAZH_0853Help
Entry
LCAZH_0853        CDS       T01280                                 

Definition
IMP dehydrogenase
Orthology
K00364  
GMP reductase [EC:1.7.1.7]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LCAZH_0853
Enzymes [BR:lcz01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.7  GMP reductase
     LCAZH_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(834441..835430)
Genome map
AA seq 329 aa AA seqDB search
MNNGMQIFDYEDIQMIPNKCVVQSRKEVDTSVKFGPHTFKIPVVPANMQTIIDEPLAIWL
AEHDYFYIMHRFQPERRMDFVRDMKKRGLIASISVGVKDDEFDFIEALAANELTPDYITI
DIAHGYAQVVIDMIQHIKHYLPNAFVIAGNVGTPEAVRELENAGADATKVGIGPGKVCIT
KLKTGFGTGGWQLAAVRWCAKAARKPIIADGGIRNNGDIAKSIRFGATMCMIGSLFAGHE
ETPGKHVNIDGKEYQEYYGSASEYQKGTHHNVEGKKILLPVKGKIGDTLKEMQEDLQSAV
SYAGGRDLESLTKVDYVIVKNSIFNGDQY
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacggcatgcagatttttgattacgaagacattcaaatgattcctaacaagtgt
gtggtgcaatcacgtaaagaggttgataccagcgtgaaatttggcccgcatactttcaag
attccagtcgttcccgctaatatgcaaaccatcatcgatgaacctttggcgatctggttg
gcagagcacgattacttctatattatgcatcgcttccagccggaacgccggatggatttt
gttcgcgatatgaaaaagcgcggcttaatcgcttcaatcagtgtcggcgtcaaggatgac
gagttcgattttatcgaagcgctggctgctaatgagctgactcctgactatatcaccatt
gatattgcccacggttatgctcaggtggtcattgacatgattcaacatatcaaacattat
ttgccaaatgcctttgtgattgccggtaatgtcggcaccccagaagctgtccgggaactt
gaaaacgctggtgccgatgctaccaaagtcggcatcggtcctggcaaggtctgcatcacc
aaattaaaaaccggttttggtacgggcggctggcaattagctgctgttcgttggtgcgcc
aaagcagcccgtaaacccatcattgctgatggcggcattcgcaataatggtgacatcgcc
aagtcaatccgctttggcgccaccatgtgcatgattggttccctttttgctggccatgaa
gaaacacctggcaaacacgtcaacattgacggcaaggaatatcaggaatattacggttca
gcgtccgagtatcaaaagggcacccaccacaacgttgaaggcaaaaagatcttgttacct
gtcaaaggcaagattggtgacacgttaaaggaaatgcaagaagacttgcagtcagctgtc
tcctacgccggtggccgcgatctcgagtccttgaccaaggtcgattatgtcattgttaaa
aactcgattttcaatggcgatcaatattaa

DBGET integrated database retrieval system