KEGG   Lactobacillus casei Zhang: LCAZH_0918Help
Entry
LCAZH_0918        CDS       T01280                                 

Definition
esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lcz  Lactobacillus casei Zhang
Brite
Enzymes [BR:lcz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     LCAZH_0918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
906248..906982
Genome map
AA seq 244 aa AA seqDB search
MIFREPQPFEYEGTDTGVVLLHAYTGSPNDMNFMGRALQRAGYGVYAPLFTGHGTIEPMD
ILTKGNPDIWWAEASAAVSHMTAKYDRVFVFGLSLGGIFAMKALEILPGVTAGGVFSSPI
LPGKHHLVPGFLKYAQYMNRLAGVPDESTQILAYLPGQLAAIDNFATGVAADLYLVNKPI
FIGQAGADELVDGQLAYQLRDALINAPQVDFHWYDNAKHVITVNSAHHALQQDVIAFMQQ
ENEG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgatctttcgtgaaccgcaaccattcgaatacgagggcactgataccggtgttgttttg
ctgcatgcctatactggcagcccaaacgacatgaacttcatggggcgggccttgcagcgg
gctgggtatggcgtgtatgcgccgttgttcacgggacatggtaccattgagccaatggat
attctgactaagggcaacccagatatttggtgggcagaggccagcgcggctgtttcgcat
atgacagcaaagtatgaccgtgtttttgtttttggattatcactcggcggtattttcgcc
atgaaagctttggaaatattacccggtgtcacagctggcggcgttttttcatcgccgatc
ttaccgggcaagcaccatctcgtgccagggtttctgaaatacgcacaatatatgaatcgt
ttggcaggtgtaccagacgaaagtactcagattttggcttacttaccaggtcaactggcg
gcgattgacaatttcgccactggggttgccgccgatctgtatttagttaataagccgatc
tttatcggccaagccggtgctgatgaattagttgacgggcagctggcctatcagctacgg
gatgcactcatcaatgcaccgcaagtagattttcattggtatgacaatgccaaacatgtg
atcaccgtgaattcggcacatcacgcactacaacaagacgttatcgcatttatgcaacaa
gaaaacgagggatag

DBGET integrated database retrieval system