KEGG   Lactobacillus casei Zhang: LCAZH_1030Help
Entry
LCAZH_1030        CDS       T01280                                 

Definition
lysophospholipase l1-like esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LCAZH_1030
Enzymes [BR:lcz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     LCAZH_1030
   3.1.2  Thioester hydrolases
    3.1.2.-  
     LCAZH_1030
Lipid biosynthesis proteins [BR:lcz01004]
 Fatty acid synthase
  Component type
   LCAZH_1030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1002942..1003733)
Genome map
AA seq 263 aa AA seqDB search
MKKFWLGFGLLLLILAAGCGVQHKVAKSSSSAASLRSRKSPSSRSSAAIKQTSMLARLKA
KSQTTLVYAPFGDSLSVGLFADSKTSRFTTLFADQLHRLTDKTVTEEGIAEVGKTATNLG
VPALPALIAQHPDLITIEFGTNDAVGGATPTALADYRQALTTIVATLQKQTTAELILMTT
WSPNHGPYAAADLQFDAVVKQIGQTYHVPVADLATIWQNHDDVTGPAGTAITDFAGNGPR
DTFHPNQRGHDQIAALLKKTLEE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttttggttgggttttggtcttttattgctcattttagcagctggctgcggg
gtacaacataaagtggctaaatcgagcagttcagcggcttcgcttcgcagccgcaagtcg
cctagttcgcgatcctcagctgcgattaagcagacaagcatgctcgcccggctgaaggca
aaatcacaaacgacgctcgtgtatgcaccgtttggcgacagcctctctgttggtttgttt
gcggatagtaaaacaagccggtttaccaccctttttgctgaccaattacaccgtttgact
gacaagacggtgacagaggaagggattgcagaggtgggaaaaaccgcgactaatcttggt
gtccctgctctgccagcgttgattgcccagcatcctgatttgattaccatcgagtttggg
acgaacgatgcggttggcggcgccacaccaacggcgctggctgattaccgccaggcgttg
acaaccatcgtggcaaccttgcagaagcaaacaacagctgagttgatccttatgacgacc
tggtcgccaaaccatggtccttatgccgccgccgatttgcaatttgatgctgtggtcaaa
caaatcggtcaaacttatcacgttccagttgccgatctggcgaccatctggcaaaaccat
gatgacgtcacaggccctgccggtacagccatcaccgacttcgctggtaacggtccgcgc
gatacttttcaccccaaccagcgcggtcatgatcagattgctgccttgctcaagaaaact
ttggaggaataa

DBGET integrated database retrieval system