KEGG   Lactobacillus casei Zhang: LCAZH_1073Help
Entry
LCAZH_1073        CDS       T01280                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LCAZH_1073
   00052 Galactose metabolism
    LCAZH_1073
   00500 Starch and sucrose metabolism
    LCAZH_1073
   00520 Amino sugar and nucleotide sugar metabolism
    LCAZH_1073
Enzymes [BR:lcz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LCAZH_1073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1045528..1046442
Genome map
AA seq 304 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEAKASGIEDILIVEGKQK
RSIEDHFDSAPELEQNLKEKHKDALLELVHSTTDIGVNLFFVRQPYPRGLGDAVRLAKSF
VGDEPFVVMLGDDLMHDKVPLTKQLINEYDKTHASILAVKKVPHDEVSAYGVIDPEKEVS
KGLFNVKKFVEKPAVADAPSDLAIIGRYLLTPEIFDILENQKPGKGNEIQLTDAIDTLNQ
TQRVFAHEFTGDRYDVGNKFGYVKTNIEYGLTHPEVKDELRAYILDLASKLQANKPVGKP
ANKK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagttcgtaaagcagtcattccggcagccgggcttgggacccgctttctgccagca
actaaagctttagccaaagagatgttaccaatcgttgataaaccaaccattcagttcatc
gttgaagaggctaaagccagcgggattgaagacattctgatcgttgagggtaaacaaaag
cgttctattgaggaccatttcgattctgctcctgaattggagcagaatttgaaagaaaaa
cataaagatgccttgttggagttggttcactccaccactgacatcggcgttaatctcttc
ttcgttcgccagccatatccgcgcggccttggggatgccgttcgtttggcaaagtcattc
gttggcgacgaaccatttgttgtcatgctcggcgatgacctgatgcatgacaaggtaccg
ttgaccaagcaactgattaacgaatacgataagacccacgcatccattcttgctgttaaa
aaagtgccacatgacgaagtttcagcttatggcgttattgaccctgaaaaagaagtttca
aagggactcttcaacgtcaagaaatttgttgaaaagccagctgttgccgatgcaccaagt
gacttggccatcattggtcgttacttgttgacaccagagatctttgatattctcgaaaat
caaaaacctggtaagggtaacgaaattcaactcaccgatgccatcgacaccttgaaccaa
acccagcgtgtcttcgcccatgaattcaccggcgatcgttatgatgttgggaataagttt
ggctatgtgaagaccaacatcgagtacggcttgacccatccagaagtgaaggatgagctg
cgtgcttatattcttgacttggcttcaaagctgcaggcaaataagcctgtggggaagccc
gcaaataagaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system