KEGG   Lactobacillus casei Zhang: LCAZH_1142Help
Entry
LCAZH_1142        CDS       T01280                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LCAZH_1142
Enzymes [BR:lcz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LCAZH_1142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1112676..1113266
Genome map
AA seq 196 aa AA seqDB search
MAQLFFRYGAMNSGKSIEILKVAHNYEEQNKRVILMTSAVDDRAGVGMIASRIGLERTAI
PITHETNLYDIIKATDPKAACVLIDEAQFLQKHHIFEAARVVDELHIPVMAFGLKNDFRN
ELFEGSKYLLLYADKIEEMKTICWFCAKKAIMNLRIHDGQPVYEGKQVLIGGNESYYPVC
RHHYFHPPLKQIDPAD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcttttctttcgttacggtgcgatgaactccgggaaaagtattgaaatcctg
aaggttgcgcataactatgaagaacaaaataagcgcgtaattttgatgacaagtgccgtg
gatgatcgtgccggcgtcggtatgattgccagtcgaatcggcttagaacgcacggcaatt
ccgattacacacgaaaccaacctttacgacatcatcaaggcaactgatcctaaggctgcc
tgtgtgttgatcgatgaggcgcagttcctgcagaaacatcacatttttgaagcagcacgt
gtggttgatgaattacatattccagtcatggcgttcggtttgaaaaatgatttccgcaat
gagctgtttgaaggttcaaaatatttattactctatgcggacaaaattgaagaaatgaaa
acgatctgctggttttgtgccaaaaaagcgatcatgaatttacgaattcatgatggccag
ccagtctacgaaggcaaacaagtactgattggtgggaatgagtcgtattatccagtttgc
cgacatcattattttcatccgccattgaagcagattgaccctgccgattaa

DBGET integrated database retrieval system