KEGG   Lactobacillus casei Zhang: LCAZH_1164Help
Entry
LCAZH_1164        CDS       T01280                                 

Definition
acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase-like deacylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lcz01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lcz00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1129621..1130745)
Genome map
AA seq 374 aa AA seqDB search
MTEPIALLQKLIQINSVNGNELAVAKLLQAELEAADIPTKLIPYTEDRVNLIAELNHGDR
VLGFTGHEDVVSPGDESAWTYPPFSGKVVDNVMYGRGTDDMKSGLAAMVLALIALKQSGF
THPIRLIATVGEEYGAMGARLLTEQGYADDLAGLVVGEPTTKILKYAHAGTVNYEIDSEG
VSVHSSRPEKGVNAIDGLTTFAALEHHAFDKAPADPDLGPFRHSITVINGGDQVNTIPAH
AFLRGNLRPTPSANIELVVKMLEDLVAHVNATTNAKLTLKVLHRFLPVHSDKTGHLVTSA
NAAIAAVTGKPAELAVAFGGTDASEFIKSSNHFDVIVYGPGDNHFSHQVNEHIDLNSYTT
AIKIYQEIAKRFFE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaccaattgccctgctccaaaagctgattcaaatcaattctgtaaatggcaac
gagctcgccgtcgccaaactgctgcaagccgaacttgaggctgccgatattcctaccaag
ctgatcccctacacagaagaccgcgtgaatttaattgccgaattaaaccatggtgatcgc
gttctcggtttcactggccacgaagacgttgtgagtcctggagacgagtcagcctggacg
tacccacctttttccggcaaagtcgtcgacaatgtgatgtatggtcgtggcaccgatgat
atgaaaagcggtttagccgccatggtgctggccctgatcgccctcaaacaatccggattc
actcatccgattcgcttgattgcaacggtaggcgaagaatacggtgcgatgggcgctcgt
ttgctgacagagcaaggctatgccgatgatctcgctggcttagttgttggtgaacccacc
actaaaatcttaaaatatgcacatgctggtaccgtgaattacgagattgacagtgaaggc
gtctctgtccatagttctaggcctgaaaaaggcgtcaatgccatcgatggtctaacgact
tttgccgcactggaacatcacgcctttgacaaggcgcctgctgacccggatctcggccca
tttcgacattcaatcacggtcatcaatggcggcgaccaagtcaacaccattccagcccac
gctttccttcgtggcaatcttcgcccgaccccatcggccaatattgagctggttgtgaaa
atgcttgaagacttagtggcacatgtcaacgccacgaccaatgcgaaactcacgttgaaa
gtattgcaccgttttctgccggttcactccgataaaacaggccacttggtaacttcggca
aatgctgccatcgcggcggtaactggtaaaccagctgaattagccgttgcgtttggagga
accgatgcttccgagttcatcaaatcatctaaccattttgatgtgattgtctatggcccc
ggtgataaccacttcagtcatcaagtgaatgaacacatcgacctgaacagttacacaacg
gcgatcaaaatttatcaagaaattgccaagcgcttcttcgaataa

DBGET integrated database retrieval system