KEGG   Lactobacillus casei Zhang: LCAZH_1290Help
Entry
LCAZH_1290        CDS       T01280                                 

Definition
ATP-dependent exoDNAse
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LCAZH_1290
Enzymes [BR:lcz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LCAZH_1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1246065..1248533
Genome map
AA seq 822 aa AA seqDB search
MDTREETVTGRVKSIFFQNPTNFFKILLIEISATTITWTESDIVVTGTFGDIKEDATYTF
TGHVVDHPKYGQQFQADNYHADQPTNKSGLVDYLSSDKFPGIGPKTATKIIDHLGMDAID
KILDDPKVLAGLGMTAAKRDMLATNLKSNQGMERVIIGLNDYGFTSNMAGRIYQQYQNDA
LDVIKHNPYQLINDIDGIGFTRADQIAAKLAIAPTSQLRLGGAVMDTLQRLTDGEGDTYV
TLKSLVTQTLDLLERARNVAVSPDAVGQAIVTLAKDNALIAEGDRIFPKRLYDAEWQIGR
QLKGLAEADATATEPELAEIEKTLAAVEADTGIAYDATQRKAIVTALQSPIFLLTGGPGT
GKTTVTDGIVRTYARLHDLSLDLDQYTTDEPFPIMLAAPTGRAAKRISETTQLPASTIHR
LLGLGVDTQEFAPNELPNGLLIIDEMSMVDTYLFRTLLTALHPGMKIVLVGDKDQLPSVG
PGQVFADLLRSGVLPQTALTHIHRQDADSSIIPLAHAVNAGKLPDDFTKPQVDRSFLACA
PSQVPEVVGQVVQRAAVKQFSIADIQVLAPMYRGTAGIDRLNPLLQNILNPKRSARTKAI
QFGETEYRIGDKVLQLVNDPNQNVFNGEIGQIVGITLGKEAESKTDELTIDFDGNEITCK
RSDFNKITLAYATSIHKAQGIEFPMVILPLTLQSRRMLRRNLLYTAITRAKSFLILVGEL
AAFQEAVSEVAVNRHTGLVDRLMTVFGKTVAPQVADASATKDISASPSEPQIDTTALDLD
NEVKQQPPAAHQLTPALVASQRIDPMIGMDGITPQMFMTKEN
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atggacacgcgtgaggagactgtcaccggtcgggtcaaaagtatctttttccagaatcca
acaaatttttttaaaattcttctgatcgaaatctctgcgacgactatcacctggacagag
tcagatattgtggtgacaggaacgtttggtgatattaaggaagatgcgacctacacgttc
actgggcatgtcgtggatcatcctaagtatgggcagcagtttcaagcagacaattaccat
gcggatcagccgacgaataaaagtgggctggtcgattatttgagctcagataagttcccg
gggatcggtccgaaaacggcaacgaaaattatcgatcatttgggtatggatgctattgac
aagattctggatgatccgaaggttttggcaggcttaggcatgacagctgccaagcgtgat
atgttggcgacaaatctgaaatcgaatcaaggcatggaacgggttattattggtcttaac
gattacggctttactagcaatatggcaggtcgtatttaccaacaatatcaaaatgacgcc
ttagatgtgattaagcacaatccgtatcaattgattaacgatattgatggtatcggcttt
actcgggctgatcagattgcggcaaaattggcgattgccccgacttcgcagcttcgtctt
ggcggtgcagtgatggataccctgcaacggttgaccgatggcgaaggtgatacctatgtg
acgctgaagtcattggtcactcagacacttgatttattggaacgggcgagaaacgttgcc
gtttcgccagacgcagtaggacaggcaattgtgacgctggctaaagacaatgccctgatt
gcagaaggcgaccgcattttcccgaaacgattatatgatgctgaatggcagattggtcgg
caactaaaaggactggcagaggcagacgcaacggctactgaacctgaattggctgagatt
gaaaaaacgttagcggcggtcgaggcggataccggtattgcgtatgatgcgacgcaaaga
aaagccattgtcacggcgttacagtcgcccatttttctgttgactggaggacctggtact
gggaaaaccacagtaacagatggtatcgtgcggacgtatgcacggttgcatgacctttca
ttggatcttgatcagtatacgactgacgagccatttccaatcatgctggcagcgccaacc
gggcgagcagcgaaacggattagtgaaaccacccaactgccagccagtacgattcatcgc
ctgctcggtttaggtgttgacacgcaagaatttgcacctaatgagttaccaaatggcctg
ttgattattgatgagatgtcaatggttgacacttacttgttccggacgcttttaacggca
ttacatcccggaatgaaaattgtcttggttggcgataaagaccagttaccaagtgtcggt
cccggacaagtattcgctgatttattgcgcagcggcgtgctgccgcaaacagcgctgacg
catattcatcgtcaggatgccgacagttcaattattccgctagcgcatgcagtgaatgct
ggcaagttgccggatgattttaccaagccgcaagttgatcgcagttttttggcgtgtgcg
cctagtcaggtacctgaagttgtcggacaagtggtgcaacgagccgcagtcaaacaattc
tcgatcgcggatattcaagtgttggcacctatgtaccgcggaaccgctggtattgatcgt
ttgaatccgttactgcaaaacattttgaatccaaaacgcagtgcccgaacgaaagcaatt
cagtttggagaaacggaatatcgaattggtgataaggtgttgcaactggtcaatgatccc
aaccaaaatgtttttaacggtgaaatcggtcagattgtcggcattactttgggcaaggaa
gccgaaagcaagacggacgaattaacgattgattttgacggcaatgaaatcacttgcaaa
cgcagtgattttaataagattacgcttgcttatgccacctcgattcataaagcccaaggc
attgagttcccgatggtgattttgccgctcactttgcaaagccgccggatgttgcgacgt
aacttgttgtacaccgccattacgcgggctaaatcatttttgattttggttggcgaactg
gcagcctttcaggaagcggtcagtgaagtagccgttaatcgacatactgggctggtcgat
cggctcatgaccgtatttggcaaaaccgttgcccctcaggttgctgatgcttcagcaacc
aaggatatttcagcaagtcccagtgagccgcaaattgacacaactgcacttgacttggat
aatgaagttaaacaacaaccaccggcagcgcaccaattaacgcctgccttggtggcttct
caacgaatcgatcccatgattgggatggatggtatcactccgcaaatgtttatgacgaag
gagaattaa

DBGET integrated database retrieval system