KEGG   Lactobacillus casei Zhang: LCAZH_1301Help
Entry
LCAZH_1301        CDS       T01280                                 

Definition
acetoin/pyruvate dehydrogenase complex, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCAZH_1301
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCAZH_1301
   00020 Citrate cycle (TCA cycle)
    LCAZH_1301
   00620 Pyruvate metabolism
    LCAZH_1301
Enzymes [BR:lcz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LCAZH_1301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1258940..1260601
Genome map
AA seq 553 aa AA seqDB search
MAFEFKLPELGEGLAEGEIVKWDVKPGDDIKEDDTLLEVQSDKSVEEIPSPVSGKILKIL
VPEGETASVGDLLVEIDDGSGPAAAPAAPATATAAPATPAPATSAQPAPAQSVYQFKLPE
LGEGLAEGEIVKWSVKPGDQIKEDDTLLEVQSDKSVEEIPSPVAGTVVKILVPEGETATV
GEALVDIDALGHNDTSVATEAGAAPQPVAATPAATPAAPAAGGVPAITDPNREILAMPSV
RQYAREQGIDISQVPATGKHGRITKADVDAFKTGAPAASAQPAAPAAQAQPQPATAKPAA
PAAPKPQAVAPYVSSGNEAELETREKMTPTRKAIAKAMLASKQRSPHVTSFDDVEVSKLM
AHRKKYKQYAADKGIKLTFLPYIVKALVTVLREYPEFNASIDDTTDEIVYKHYFNIGIAT
NTDHGLYVPVIKNADAKSMFEIAKEISENAQKAYDSKLKPDEMRGGSMTISNVGSIGGGW
FTPVINQPEVAILGVGKIAKEPYVNEDNEIVVGNMLKLSLSYDHRLIDGALAQTALNLMD
KLLADPDLLLMEG
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattcaaactgccagaacttggcgaaggtttggcagaaggcgaaatcgtt
aagtgggacgtcaaacctggtgatgacatcaaggaagacgataccttacttgaggttcaa
agtgataaaagtgttgaagagattccatccccggtctccggcaaaattttaaaaattctt
gttccagaaggggaaaccgcgtcagttggtgatctattggttgaaatcgatgatggctcc
ggaccggcagctgcaccggctgcacctgcgactgcaacagcagcccctgcgacacccgct
ccagcaacgtctgcgcaacctgcacctgcgcaatcggtttatcagtttaagttacccgaa
ttaggcgaaggtttggcagaaggcgaaattgttaaatggtcagtcaagcctggcgatcaa
atcaaagaagacgacacgctgttagaagttcaaagcgacaagagtgtcgaagaaattcct
tctccagttgccggaacggttgttaagattctggtaccagaaggcgaaaccgcgacagtc
ggtgaagcgctggttgatattgatgcactgggtcataatgacacatcggttgctactgag
gctggcgctgcaccgcagccggttgctgcaacaccggctgcgacgccagctgcaccagca
gcgggtggcgtgccggccatcaccgatccgaaccgggaaattttagcaatgccatctgtg
cgtcagtatgcacgcgaacagggcattgacatctcacaagtgccagcaaccggcaaacat
ggccggattaccaaggctgatgtcgatgcattcaagacgggcgcaccagctgcatctgca
cagccagcagcccctgctgctcaggcacaaccgcaaccagccacagcaaagccagctgca
ccggcagcaccaaagccgcaagcagttgcaccatacgtttcgagtggtaatgaagctgaa
cttgaaacccgtgaaaagatgaccccaactcggaaagcgattgctaaggcgatgcttgct
tctaagcaacgtagcccgcatgtgacgagttttgatgacgttgaagtttctaagttaatg
gctcatcgcaagaagtacaagcaatacgcagctgataaaggtatcaagttaaccttcctg
ccgtatatcgtcaaagcacttgtgacggtgttgcgtgaatatccggaattcaatgcgtcc
attgatgatacaacggatgaaattgtctataagcattacttcaacattgggattgcaacg
aatacggatcacggcttgtatgtgcctgtgatcaagaatgccgatgcaaagagtatgttt
gaaattgctaaggaaattagtgaaaatgcccagaaggcttatgacagcaaactaaagccg
gatgaaatgcgcggtggctccatgaccatcagtaacgttgggtcaattggcggcggctgg
ttcaccccagtgatcaatcaacctgaagttgcgattctcggagtgggcaaaattgctaag
gaaccttatgtcaacgaagacaacgaaattgtggttggcaacatgttgaaattaagtttg
agctatgaccatcgtttgattgacggcgcgttagcacaaaccgccttgaatctgatggat
aaattgttggcagatcctgatctgctgttgatggagggataa

DBGET integrated database retrieval system