KEGG   Lactobacillus casei Zhang: LCAZH_1351Help
Entry
LCAZH_1351        CDS       T01280                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCAZH_1351
   01230 Biosynthesis of amino acids
    LCAZH_1351
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCAZH_1351
   00030 Pentose phosphate pathway
    LCAZH_1351
   00051 Fructose and mannose metabolism
    LCAZH_1351
   00052 Galactose metabolism
    LCAZH_1351
  Energy metabolism
   00680 Methane metabolism
    LCAZH_1351
Enzymes [BR:lcz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LCAZH_1351
Protein phosphatases and associated proteins [BR:lcz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LCAZH_1351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1318301..1319260
Genome map
AA seq 319 aa AA seqDB search
MKRIGILTSGGDAPGMNAAVRAVARKAMHEGLEVYGINYGFAGLVAGDIFKMNESTVGDK
IQRGGTMLYSARYPQFAQEEGQLRGVEQLNKFGIEALVVIGGDGSYHGALALTRHGFNTI
GLPGTIDNDIPYTDFTIGFDTAVNTVVEAVDRLRDTAASHERTFVIEVMGREAGDIALWS
GVAGGAEDVIIPEHDFDVKKIASKLQSSRERGQKHAVILLAEGVMHADQFAKELAAHGDF
QLRSTVLGHIVRGGAPSARDRVLASQMGSYAVELLLQGKGALAVGIENNKITAHDVRTLF
DAKHHAELSLYTLAEELTF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttgaccagtggcggggatgcgcctggcatgaacgccgcggtc
cgcgctgttgctcgcaaggcgatgcacgaaggccttgaagtatatggcatcaattatgga
tttgctgggttagttgccggcgacattttcaaaatgaatgaatcaactgtcggtgataag
attcaacgcggcgggaccatgttatattccgcacgttatccacaatttgcgcaagaagaa
ggccagttgcgcggggtcgaacaattaaacaagtttggcatcgaggcgttggtcgtcatc
ggcggagacggctcttatcacggtgcactagctttgacgcgtcacggtttcaacaccatt
ggcctgccaggaacgatcgacaacgatattccttacacggacttcacgattggctttgat
actgccgttaatacagttgtggaagctgttgaccgtcttcgcgataccgcggcttcgcat
gaacgaacctttgtcattgaagtcatgggtcgtgaagctggggacattgccctttggtcg
ggcgtcgccggtggtgccgaggatgtcatcattccagaacacgactttgacgttaagaaa
attgcgtcgaagttgcaaagttctcgtgaacgtggtcaaaagcatgcggtcattcttttg
gcagaaggcgtgatgcacgctgatcaatttgccaaggaattagccgcacatggcgatttc
caattacgttcgacagttctgggacacattgttcgtggcggtgcaccgtccgcacgtgat
cgcgttttggcttcacaaatgggctcatacgcggttgaacttttgttgcaaggcaaaggc
gctttggctgtcggcattgagaataacaagatcacggcacatgatgttcggaccttgttt
gatgccaagcatcacgcagaactttcgctctacaccttagcggaagagttaacattttaa

DBGET integrated database retrieval system