KEGG   Lactobacillus casei Zhang: LCAZH_1619Help
Entry
LCAZH_1619        CDS       T01280                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lcz00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1587267..1587893)
Genome map
AA seq 208 aa AA seqDB search
MHERGMLIVLSGPSGVGKGTVRQAMLDGNYRDFQYSISMTTRQMRPGEVDGVDYYFRTKA
QFEHEIATGGMLEYAKYVENYYGTPLKYVNETLDAGRDVLLEIEVNGAMQVRKKCPNGVF
IFLTPPDLSELRHRLKGRGTDDDVTIDKRIRKAASEITMMENYDYAVVNDKVDLAVKRIE
RIIESEHLRVPRVIDRYKGMLASADLAR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcacgagcggggaatgctaattgttttgtccgggcccagcggtgtcggtaagggaacg
gttcggcaagcaatgctggatggtaattatcgagattttcaatattcaatttcaatgacg
acacggcaaatgcggcctggtgaggttgatggtgtcgattattactttaggacgaaagcc
cagtttgagcacgaaattgcgacaggtggtatgctggagtatgcgaaatatgttgagaat
tactacggcacaccgttaaaatatgtgaacgaaactttggatgccggccgcgatgttcta
ctggagatcgaggttaacggtgccatgcaggttcgcaaaaaatgtccaaacggtgtcttc
atcttcttgacaccaccagatcttagcgagttgcgccaccggttgaaaggacgcggcacg
gatgatgatgtgaccattgataaacggattcgcaaagcagcttcggagatcaccatgatg
gaaaattatgattatgccgtggtgaatgataaagttgacttagcagttaagcgcatcgaa
cgcattattgaaagcgagcacttgcgggtgccacgcgtcattgatcgttacaagggcatg
ttagcaagtgcagatttggcaagatag

DBGET integrated database retrieval system