KEGG   Lactobacillus casei Zhang: LCAZH_1649Help
Entry
LCAZH_1649        CDS       T01280                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lcz  Lactobacillus casei Zhang
Pathway
lcz00010  Glycolysis / Gluconeogenesis
lcz00052  Galactose metabolism
lcz00500  Starch and sucrose metabolism
lcz00520  Amino sugar and nucleotide sugar metabolism
lcz00521  Streptomycin biosynthesis
lcz01100  Metabolic pathways
lcz01110  Biosynthesis of secondary metabolites
lcz01120  Microbial metabolism in diverse environments
lcz01130  Biosynthesis of antibiotics
lcz01200  Carbon metabolism
Module
lcz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lcz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCAZH_1649
   00052 Galactose metabolism
    LCAZH_1649
   00500 Starch and sucrose metabolism
    LCAZH_1649
   00520 Amino sugar and nucleotide sugar metabolism
    LCAZH_1649
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LCAZH_1649
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LCAZH_1649
Enzymes [BR:lcz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LCAZH_1649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ADK18877
Position
complement(1611583..1612545)
Genome map
AA seq 320 aa AA seqDB search
MNDKKLIGVDLGGTTVKFAILTTDGEIQQRWSIDTNILDEGSHILPDIIDSINEHLKLYN
MTPNDFVGIGMGSPGSVDIEAGTVIGAYNLNWKTLQQAKKDIEAGTGIPFSIDNDANVAA
LGERWKGAGENDANVTFVTLGTGVGGGIIADGNLLHGVAGSAGELGHVTVDPVNGYLCTC
GKRGCLETVASATGVVRVARDMAEEFAGDSKLKQTLDDGDEISSKIVFDLAKTGDKLALM
IVDRVSYFLGLALANVGNLLNPKFIVIGGGVSAAGDFLLKRVDKYFKENTFPNVRETTSL
RLATLGNTAGVIGAASLALK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacaaaaaattaattggtgtcgatctgggcggcacaacggttaaattcgcgatc
ttaaccactgatggtgagattcaacagcgctggagcatcgatactaatattttggatgaa
ggcagtcacatcttgccggatatcattgattcgatcaacgaacatctcaaactctacaac
atgacaccgaatgattttgtcggtatcggtatgggctcacctggttccgttgatattgaa
gcaggcacggtaattggcgcttacaacttgaattggaaaaccttgcagcaggctaagaag
gatattgaggctggtactgggattccctttagtattgataacgacgccaatgttgctgcc
ttgggcgaacgttggaaaggcgctggcgaaaatgacgccaatgtaactttcgtaacgctt
ggcacaggcgttggcggcggcattattgccgatggtaacttattgcatggtgttgcaggc
tcagcaggcgaacttggacatgtgactgttgatccggtgaatggttatctctgtacttgc
ggcaaacgcggttgtctcgaaactgtagccagtgcgactggcgttgtccgggtggcccgg
gatatggctgaagaattcgctggcgactccaaactgaagcagacgttagatgatggcgat
gagatttctagcaaaattgtttttgatcttgccaaaaccggcgacaaacttgcgttgatg
attgttgaccgggttagctactttcttggcttggcattggcaaatgtcggcaatctgctg
aatccgaaattcatcgtcattggtggcggcgtttcagcagcaggtgactttttgctgaag
cgagttgataagtatttcaaggaaaatacgttcccgaatgttcgggaaacaacaagtctg
cgtctggcaacgctaggtaacactgctggcgttatcggagctgccagccttgcacttaag
taa

DBGET integrated database retrieval system