KEGG   Lactobacillus casei Zhang: LCAZH_1966Help
Entry
LCAZH_1966        CDS       T01280                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lcz  Lactobacillus casei Zhang
Pathway
lcz00230  Purine metabolism
lcz01100  Metabolic pathways
Module
lcz_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LCAZH_1966
Enzymes [BR:lcz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LCAZH_1966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 T2SSE AAA_28 ABC_tran AAA_30 CoaE AAA_16 SRP54 AAA_23 AAA_33 ResIII DUF3391 NTPase_1 AAA_19 AAA_25
Motif
Other DBs
NCBI-ProteinID: ADK19177
Position
complement(1921344..1921946)
Genome map
AA seq 200 aa AA seqDB search
MKAAHKLIVITGATGTGKTTVSGYLRDNYRIHRVMTHTTRPARTGEKNGVDYYFETPASF
ATKHFIEKVTYAGYEYGSSHESLEKNWTKHPFLSIVLDTKGAITYVRELPKEVVVLFLTI
DNPTVLKDRLLSRGDDPAMVAARLKSPEYKRDLTLPDELKPFATVIKNDSWDEAREQVDQ
FMKTLALKSCGLARIDLEQK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcgcataagttgattgtgatcactggggcaacagggactggcaaaacgacg
gtgagtggttatcttcgcgataattatcgcatccaccgcgtgatgacgcacaccacccgt
ccggcgcgcacaggggaaaagaatggggtcgattactatttcgaaacaccggcgagtttt
gcgaccaaacattttatcgaaaaagtcacttatgctggttatgagtacggttcctcccat
gaatcgcttgaaaaaaactggaccaagcatcccttccttagtattgttctagacacaaaa
ggtgccattacctatgtgcgtgagttgccaaaggaggtcgtggtcttatttttaacaatt
gataacccaacggtattaaaagatcggttgttgagccgtggtgatgatcctgccatggtt
gctgcgcggttgaaaagtccggaatataaacgcgatttaaccttgccagacgaactaaag
ccgtttgccactgtgatcaaaaatgacagttgggatgaggcgcgcgagcaagtggatcaa
tttatgaaaaccttggctttgaaaagttgcggccttgcccgcattgatttagaacaaaaa
taa

DBGET integrated database retrieval system