KEGG   Lactobacillus casei Zhang: LCAZH_1985Help
Entry
LCAZH_1985        CDS       T01280                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lcz  Lactobacillus casei Zhang
Pathway
lcz00010  Glycolysis / Gluconeogenesis
lcz00030  Pentose phosphate pathway
lcz00051  Fructose and mannose metabolism
lcz00680  Methane metabolism
lcz01100  Metabolic pathways
lcz01110  Biosynthesis of secondary metabolites
lcz01120  Microbial metabolism in diverse environments
lcz01130  Biosynthesis of antibiotics
lcz01200  Carbon metabolism
Module
lcz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCAZH_1985
   00030 Pentose phosphate pathway
    LCAZH_1985
   00051 Fructose and mannose metabolism
    LCAZH_1985
  Energy metabolism
   00680 Methane metabolism
    LCAZH_1985
Enzymes [BR:lcz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LCAZH_1985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: ADK19196
Position
complement(1943624..1945555)
Genome map
AA seq 643 aa AA seqDB search
MDLYSELTAKYQTVPAIATEIINLEAILNLPKPTEAFMSDIHGEYNAFQHVLRNGSGNVK
SKIRSCFRDEMTEATLQRFAFLVYYPSERMAAIHREMAGDDLQQWYLTTFRRLIRLLAFT
ATKYTRSKVRKAMAPEFVYITEELLYNDADTPDKLAYYWQIIRNLIVLEQADQWIAATCQ
TIQRLTVDHFHVVGDIYDRGPAPDQVVESLIRRDRRHSVDIQWGNHDILWIGGAAGSALC
IANLVRISARYNNLSILEDVYGINLRHLARLAEQYYQDNLAFSPKMERSDRPITEAERLQ
ITQIHQAIAMIQFKLEGPVIKRRPEFDMDHRLVLEKLAPDFSTIKLNGDTYTIENGCFAT
VDPADPYKLLPEEQEVIDSLVESFTHSEKLHRHMDFLLDHGSMYLRYNRNLLLHGCVPVD
EDGHFIGLTIKGTTYTGRQLFDMLEANLRLAYSQPTENADLATDLMWYLWTGPNSPLFGK
HDMTTFERYFISDPKAHVEGRNPYYHLRKDPEFIKKILAEFVLDPEVGHVINGHTPVKKG
TDPIMANNKMIVIDGGFSKPYQKTTGIGGYTLLDNSYGMQLVTHQPFTTKADAIANLTDI
ISTRRVVETEARRRTVAETDIGTELQDEVEVLKRRLGELREED
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggacttgtacagtgaactgacggcgaagtatcaaacggtgccagcgattgcgactgaa
atcattaatctggaagccattttgaatttgcctaagccgacggaagcgtttatgagcgat
atccacggggagtataacgcctttcagcatgttttgcggaacggcagcgggaatgtgaaa
agcaaaattcgttcctgttttcgcgatgaaatgacggaggcgaccctgcagcgcttcgct
tttttggtgtactatccgtctgagcgaatggcggcgattcatcgggagatggcgggggat
gacttgcaacagtggtatttgacgacttttcgccggttgattcgcttgctggcgttcacc
gcgaccaaatacacgcgttcgaaagttcgcaaggcgatggcaccggagtttgtctacatc
accgaagagttgctgtacaatgatgccgatacgcctgacaagctggcttattattggcaa
attattcgtaatttaatcgttcttgaacaggccgatcagtggattgcggcaacatgtcaa
acgattcaacgtttaacggtagatcactttcacgttgtaggcgatatctatgatcgagga
ccggcgccggatcaggtggttgaaagcttgattagacgtgatcggcgtcattcagtggat
attcaatggggcaaccatgatattctttggatcggcggcgccgcgggctcggctttgtgc
attgccaatttggtgcggatttccgcgcggtataacaatttaagtattctcgaagatgtt
tatgggattaatttgcggcatttggcccgattagcggaacaatactatcaagataatctc
gccttttcaccaaaaatggagcgatcagatcgaccaattactgaggcggagcgacttcaa
attacccagattcatcaggcgattgcgatgattcaatttaagttggaaggaccagtgatt
aaacgtcggcctgaatttgacatggatcatcggctagtgctggagaaactggcgcccgat
ttctcaaccatcaagttgaatggtgatacttatacaattgaaaacggctgttttgcgacg
gttgatccggctgatccttacaagttgttgccagaggagcaagaggtcattgactcgctg
gttgagtcctttacgcactctgaaaagttgcatcgccacatggattttctacttgatcac
ggcagcatgtatttgcggtacaaccggaatttgttgctgcacgggtgtgtgccggtggac
gaggacggccattttattggcttgaccattaaagggacgacttatactggccgtcaacta
tttgacatgctggaagcaaatcttcggttggcatacagtcaaccaacggagaatgcggac
ttagcaactgatctgatgtggtatctctggaccggtccaaattcaccgctttttggcaag
cacgacatgacgacctttgaacgctatttcattagcgatccgaaagcccatgtcgaaggc
cgtaatccatattatcacctgcgtaaggatccagaatttatcaaaaaaatcttggcggaa
tttgtcctcgatcctgaagtcggccatgtcattaatggtcatacgccagtcaaaaagggc
accgatcccattatggcaaacaacaaaatgatcgtcatcgacggcggcttttctaaaccg
tatcaaaaaaccaccgggatcggcggttacacgcttttggataattcctatggcatgcag
ctagtaacgcaccaaccattcaccacaaaagccgatgctatcgccaacctcaccgatatc
atttcaacccgccgcgtcgtcgaaaccgaagcccggcgccgaacggtagcagaaactgac
attggcactgagctacaggatgaggttgaggtgttgaagcggcgattgggtgagttgcgg
gaagaggactag

DBGET integrated database retrieval system