KEGG   Lactobacillus casei Zhang: LCAZH_2042Help
Entry
LCAZH_2042        CDS       T01280                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lcz00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lcz00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1996399..1998621
Genome map
AA seq 740 aa AA seqDB search
MANIEYDPERQLFHLHNDTFSYVIQVIRGYLVKRYCGPALDHFSGTAKLEDFSHAFNIQN
DAAPYSLTTLPLEYSTLMGGDYRTPAYAVRNGHGQLIGNLKFDHYQILAGNESFNGTLPT
ARTPHGQTLIITMHDETKTLAVRLKYTIVGDLPVLLKQVEYRNLTDTTLTITHAASLQLD
FDDHAYDLITLTGAHLNEAKVTRQPLTPGKKSIGSNYGASGPQGVPATILAAPATNEFAG
EALGVTLLWSGNFNYTAQVDQFDNSRLVMGLNPELFAWQLKPGKPFVTPEAAVAYTNDGL
NDLSRIFHRFFADHVMPLPRKNLIEYNTWETTYFDVSEAKILAEIPKAEELGVELLVIDD
GWFKNRPNDAGQLGDWVPDPVKFPHGLRPVADAIHARGLAFGLWVEPEMISENSELYATH
PDWAMQYVGQKPLRSRNQLILDLSQRIVQDHLITVLTNLVRDNHIDYLKWDYNRHFSQPG
SPVLPPDQQGEVGYRYTRGLYRVLKTLRDTFPKLLIENCSSGGGRLDGGMIAYTDQTWTS
DFTDPVYRMKIMNGFSLFFPLKIFVSHFTASPNLQDARLTPLHTRALLSLVGITGIECPP
SQLSPAEAAAVKASFAFYKANRKELQNGLLFRLRPSHVNQDEVCWLITNAAKTKALVLTS
VGVTSPIPHYQHVLLHYLDPKLSYQIDNTKNATGLELNHAGVTLPLAHGDFSATLMELTA
VTNLPQPTAAPTLDQIATQS
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatattgaatatgatccggaacgtcaattgtttcatttgcacaacgacaccttt
agctatgtcattcaggttattcgcggttatcttgttaaacgttactgtggaccggcgctg
gatcatttttctggtaccgccaaacttgaagacttcagtcatgcttttaacattcaaaat
gatgccgcaccttactcactgacgaccttgccgctggaatatagcacattgatgggcggc
gattaccgtacgccagcttacgccgtgcgtaacggtcacggtcagctgattggtaatctc
aagtttgaccactatcaaatccttgctggcaatgaaagctttaacggtaccttgccgaca
gcgcggacaccgcacgggcaaacgctgatcataacgatgcacgatgaaaccaagacgctt
gctgtccggctcaaatacacgattgtcggcgatttgcctgtcttgctcaaacaagttgag
tatcgtaatctgacagacacgacactgacgattactcatgctgccagccttcaactagat
tttgacgaccatgcttatgacctcattacgctgaccggcgctcatctcaatgaggccaaa
gtgacccgccagccgctgacccccggcaaaaagtcaatcggcagtaattatggcgccagt
gggccgcaaggtgtcccggcgacgattcttgcagcgccagcgaccaatgaatttgctggg
gaagctttaggggtcacgcttttgtggagcggcaattttaactatacggcgcaagtcgat
cagttcgacaacagccggctcgtgatgggactgaatccggagctctttgcttggcagctc
aagcccggcaagccatttgtcacgccggaagcagccgtcgcttacaccaacgatggccta
aatgatctcagccggatcttccaccgcttttttgccgatcatgtcatgccattgccgcgc
aaaaacctaattgaatacaacacgtgggaaaccacttattttgacgttagcgaagccaaa
attcttgccgagattcccaaagcggaagagttgggagttgagttactggtcattgatgat
ggctggttcaaaaatcggcctaacgatgctggccaacttggcgactgggtacctgatccc
gttaagtttccacatggcttgcgcccggtggctgacgcaattcacgctcgcggccttgct
tttggactttgggtcgaacccgaaatgatcagcgaaaatagtgagctctatgccacccat
cctgactgggccatgcagtatgtcggccaaaaacctctacgttctcgcaatcagcttatt
ctcgatctcagtcagcggattgtgcaggatcacttgatcacagttctaactaacctcgtg
cgcgataatcatattgattacctcaagtgggactataaccgccacttcagtcaacctggc
agtccggtactgccacctgatcaacaaggtgaagtcggctatcgctatacccgcggctta
tatcgggttttgaaaacgttacgcgacacttttccaaagctactcatcgaaaactgttcg
tccggcggtggtcgtttagatggcgggatgatcgcctacaccgaccaaacatggaccagc
gattttactgacccagtttaccgcatgaaaattatgaacggcttctcgctgtttttcccg
ctcaaaatttttgtctcgcatttcaccgcctccccgaatctacaagatgcgcggttaacg
cccttgcatacccgcgcactgttaagtctggttggcatcactggcatcgaatgcccgccg
agtcagctcagtcccgctgaagccgcggcggtcaaggccagttttgccttttacaaagcg
aatcgcaaagaattgcagaatggtttgctttttcggttacgacctagccatgttaatcaa
gacgaggtttgttggctgatcactaacgccgccaaaaccaaggcactggtcttgacttca
gtcggtgtcacttcgccgattcctcattatcaacatgtattgctgcattacttggaccca
aaattgtcttatcaaatcgacaacacaaaaaatgccaccgggttagaactgaaccacgcc
ggtgttaccttgccacttgcccatggtgatttttcggcaacgctcatggagctgacggca
gtaaccaaccttccgcaacccaccgcagcaccgacgcttgatcaaatagccacgcaaagt
tag

DBGET integrated database retrieval system