KEGG   Lactobacillus casei Zhang: LCAZH_2042Help
Entry
LCAZH_2042        CDS       T01280                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LCAZH_2042
  Lipid metabolism
   00561 Glycerolipid metabolism
    LCAZH_2042
   00600 Sphingolipid metabolism
    LCAZH_2042
Enzymes [BR:lcz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LCAZH_2042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1996399..1998621
Genome map
AA seq 740 aa AA seqDB search
MANIEYDPERQLFHLHNDTFSYVIQVIRGYLVKRYCGPALDHFSGTAKLEDFSHAFNIQN
DAAPYSLTTLPLEYSTLMGGDYRTPAYAVRNGHGQLIGNLKFDHYQILAGNESFNGTLPT
ARTPHGQTLIITMHDETKTLAVRLKYTIVGDLPVLLKQVEYRNLTDTTLTITHAASLQLD
FDDHAYDLITLTGAHLNEAKVTRQPLTPGKKSIGSNYGASGPQGVPATILAAPATNEFAG
EALGVTLLWSGNFNYTAQVDQFDNSRLVMGLNPELFAWQLKPGKPFVTPEAAVAYTNDGL
NDLSRIFHRFFADHVMPLPRKNLIEYNTWETTYFDVSEAKILAEIPKAEELGVELLVIDD
GWFKNRPNDAGQLGDWVPDPVKFPHGLRPVADAIHARGLAFGLWVEPEMISENSELYATH
PDWAMQYVGQKPLRSRNQLILDLSQRIVQDHLITVLTNLVRDNHIDYLKWDYNRHFSQPG
SPVLPPDQQGEVGYRYTRGLYRVLKTLRDTFPKLLIENCSSGGGRLDGGMIAYTDQTWTS
DFTDPVYRMKIMNGFSLFFPLKIFVSHFTASPNLQDARLTPLHTRALLSLVGITGIECPP
SQLSPAEAAAVKASFAFYKANRKELQNGLLFRLRPSHVNQDEVCWLITNAAKTKALVLTS
VGVTSPIPHYQHVLLHYLDPKLSYQIDNTKNATGLELNHAGVTLPLAHGDFSATLMELTA
VTNLPQPTAAPTLDQIATQS
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatattgaatatgatccggaacgtcaattgtttcatttgcacaacgacaccttt
agctatgtcattcaggttattcgcggttatcttgttaaacgttactgtggaccggcgctg
gatcatttttctggtaccgccaaacttgaagacttcagtcatgcttttaacattcaaaat
gatgccgcaccttactcactgacgaccttgccgctggaatatagcacattgatgggcggc
gattaccgtacgccagcttacgccgtgcgtaacggtcacggtcagctgattggtaatctc
aagtttgaccactatcaaatccttgctggcaatgaaagctttaacggtaccttgccgaca
gcgcggacaccgcacgggcaaacgctgatcataacgatgcacgatgaaaccaagacgctt
gctgtccggctcaaatacacgattgtcggcgatttgcctgtcttgctcaaacaagttgag
tatcgtaatctgacagacacgacactgacgattactcatgctgccagccttcaactagat
tttgacgaccatgcttatgacctcattacgctgaccggcgctcatctcaatgaggccaaa
gtgacccgccagccgctgacccccggcaaaaagtcaatcggcagtaattatggcgccagt
gggccgcaaggtgtcccggcgacgattcttgcagcgccagcgaccaatgaatttgctggg
gaagctttaggggtcacgcttttgtggagcggcaattttaactatacggcgcaagtcgat
cagttcgacaacagccggctcgtgatgggactgaatccggagctctttgcttggcagctc
aagcccggcaagccatttgtcacgccggaagcagccgtcgcttacaccaacgatggccta
aatgatctcagccggatcttccaccgcttttttgccgatcatgtcatgccattgccgcgc
aaaaacctaattgaatacaacacgtgggaaaccacttattttgacgttagcgaagccaaa
attcttgccgagattcccaaagcggaagagttgggagttgagttactggtcattgatgat
ggctggttcaaaaatcggcctaacgatgctggccaacttggcgactgggtacctgatccc
gttaagtttccacatggcttgcgcccggtggctgacgcaattcacgctcgcggccttgct
tttggactttgggtcgaacccgaaatgatcagcgaaaatagtgagctctatgccacccat
cctgactgggccatgcagtatgtcggccaaaaacctctacgttctcgcaatcagcttatt
ctcgatctcagtcagcggattgtgcaggatcacttgatcacagttctaactaacctcgtg
cgcgataatcatattgattacctcaagtgggactataaccgccacttcagtcaacctggc
agtccggtactgccacctgatcaacaaggtgaagtcggctatcgctatacccgcggctta
tatcgggttttgaaaacgttacgcgacacttttccaaagctactcatcgaaaactgttcg
tccggcggtggtcgtttagatggcgggatgatcgcctacaccgaccaaacatggaccagc
gattttactgacccagtttaccgcatgaaaattatgaacggcttctcgctgtttttcccg
ctcaaaatttttgtctcgcatttcaccgcctccccgaatctacaagatgcgcggttaacg
cccttgcatacccgcgcactgttaagtctggttggcatcactggcatcgaatgcccgccg
agtcagctcagtcccgctgaagccgcggcggtcaaggccagttttgccttttacaaagcg
aatcgcaaagaattgcagaatggtttgctttttcggttacgacctagccatgttaatcaa
gacgaggtttgttggctgatcactaacgccgccaaaaccaaggcactggtcttgacttca
gtcggtgtcacttcgccgattcctcattatcaacatgtattgctgcattacttggaccca
aaattgtcttatcaaatcgacaacacaaaaaatgccaccgggttagaactgaaccacgcc
ggtgttaccttgccacttgcccatggtgatttttcggcaacgctcatggagctgacggca
gtaaccaaccttccgcaacccaccgcagcaccgacgcttgatcaaatagccacgcaaagt
tag

DBGET integrated database retrieval system