KEGG   Lactobacillus casei Zhang: LCAZH_2045Help
Entry
LCAZH_2045        CDS       T01280                                 

Definition
ATP-dependent exoDNAse
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LCAZH_2045
Enzymes [BR:lcz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LCAZH_2045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2000796..2003378)
Genome map
AA seq 860 aa AA seqDB search
MANQEQVYENVDLQVIKLLFNSDNGDYKVYAVRILNPNPALKMTLTQEATITGDMGYYNR
RAIITADLVYDDAGSLRYNKPSYKLARLHFGLPKEPRRQWQLIDTLLVHQPTVRRRLHEH
FADDTPILTIFSTDQVKPDSVPGIGPATIKKIATAIRGKLEIAVLANHWGKALSSMTYEK
IWLAYKDANLAMQSIDANPYLLMSVAQLDFKKVDTFAKTRGIAANDPHRLTAGLQYIFRT
AVLTQGLTYITITWFRQQAATLLAVREADLKMFANPQEALQYGFLLNEQYGLVTSCDMFA
TEGSVARIIKVAQKTAEPLMAPDELDDALDQFLDRFHLTINDQQRAAFQNVNRHGLSVLN
GSAGTGKTWLIDLLVRFFNAQAKGKSVLLAPTGRAAKVLAKYTHEPAATIHAYLHLLPGE
ETGQFDADADWETFGDARLIVVDESSMLTTPLAYTVLKNVNFKKAHVLFVGDVFQLPPIG
PGNFLKDCLDDEQVAATTLTRVYRQDSQSGVLALANRIRDRLALPFGPDDDRYVSGNVAL
YNQRNAGRVFDAGVKAYQDALVKSGQQIDAQLLIVNKNIGATGRLRFNAELQALVNPAKN
GEPEYISSYVDPVTNQKHHLRLNDRVMILKNDKHVPLVDPKTWERRAVLGENGLQQTDDF
GTKRWRETIVANGDTGVVAHIDTKRHFVVVQIGQQYCYYSFGSVPRDLTLAYAITVHKAQ
GGQADTVIAIVNGADMMLNAQSFYTALTRTQQQFIFFGDFRVLLARTKIYPIDARHDLLG
SFLSGQLTVDTFSRYTFDQVLAWLDKRHAERLSTRPALEAEEVIPSEQPFSVRYAEQLDI
LDQIVDEVAQLPARKPARDV
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggctaatcaggaacaagtttatgaaaatgttgatctgcaagtgatcaagttgctgttt
aatagcgataacggtgattataaagtttacgccgtgcggattctgaatccgaatccggcg
cttaaaatgacgctcacccaagaggcaaccattaccggtgatatgggctactacaatcgc
cgagcgatcatcaccgctgatttggtttacgatgatgctggctcattgcgttataacaag
ccgtcttacaaattggcgcggttacattttggcttgcccaaagaaccgcgccggcagtgg
cagctgattgacacgctgctagtgcatcagccgacagtccggcgccgattgcatgaacat
tttgcagatgacaccccgatcttgacgattttttcaaccgatcaggtaaaaccggatagt
gtcccgggcattggtcccgccacaattaagaaaatcgctaccgccatccgcggcaaactg
gaaattgccgtgttggccaatcactggggcaaggcactaagctcaatgacttatgaaaaa
atttggttggcttataaagatgccaatttggccatgcaaagtattgatgccaatccgtac
ctgttgatgtcagttgcccagcttgatttcaagaaagtcgacacctttgctaagacgcgt
ggcattgcagcaaatgatccgcatcggcttacggcaggactgcaatatatttttcgcacc
gctgtactcacgcaaggattgacctatatcaccattacgtggttccggcaacaagccgcc
actttattggctgtacgcgaagccgatttgaaaatgtttgctaatccgcaagaagccttg
caatacggctttttacttaacgagcagtatggactggtgacgagttgcgatatgtttgcc
acagaaggatcggtggcgcggattattaaagtcgctcaaaaaacagccgaaccgttgatg
gctccggatgagctagatgatgcgctcgatcagtttctcgatcggtttcatttaaccatt
aatgatcaacagcgcgccgcttttcaaaatgtgaaccgtcatggcttgagcgttttgaat
ggcagtgctggcaccggtaaaacttggttgatcgatttgctggttcggttttttaacgcc
caagcaaaagggaaaagtgtcttgcttgcaccaactggccgcgccgccaaagttttggca
aagtatacgcacgagccagctgccacgattcatgcttatctgcatctactgccaggtgaa
gaaaccggccagtttgacgcggatgccgactgggaaacctttggcgatgcgcgactcatt
gtggtggatgaaagctcaatgctgacaacgccgctagcctacacggttttgaagaacgtt
aatttcaaaaaggcgcatgtgctgtttgtcggtgatgttttccaactgccgcccatcggt
cctggcaactttttaaaagattgtctagacgatgaacaggtggcggcgacaacactgacg
cgcgtttatcggcaagatagccagtccggcgtgttagcactagctaatcgcattcgtgat
cggttagcgctgccttttggaccagacgatgatcgctatgtcagcggcaatgtggcgctg
tataaccaacgcaatgctggccgggtgtttgatgctggggtgaaggcgtatcaggatgcg
ctggtcaaaagtggtcagcagattgatgcgcaattgttgatcgtgaataaaaacatcggc
gcaactggccgcttgcgatttaacgcggagttgcaagcgttggtcaacccggctaaaaat
ggcgaaccggagtatatcagcagttacgtggacccggtcactaatcaaaaacatcacttg
cgcctcaatgatcgggtcatgattttgaaaaacgataaacatgtcccgcttgttgatccg
aaaacatgggaacggcgtgcggtgctgggcgaaaatggcttgcaacagaccgatgacttt
ggcactaaacgttggcgtgagacaattgtggcaaacggcgacacaggggtggtagcccat
attgataccaaacgccattttgttgtggtccaaatcggccagcaatattgttactacagt
tttggcagcgtgccgcgcgatttgacgttggcttatgcgattacggtgcataaggcccaa
ggtgggcaggcagataccgttattgccattgtcaacggcgccgacatgatgctcaatgcc
caaagcttttatacggcgttgacgcgcacccagcagcaattcatcttttttggtgacttt
cgggtgctcttagcccgcaccaaaatctatcccatcgacgcccgccatgatttgctcggc
agttttctatccggccaactgacagtcgatacgttcagccgctatacctttgatcaggtc
ttagcttggctggataagcggcacgctgaacgcttatccacgcgacctgcgctggaagca
gaggaagtcataccaagcgagcagccattttccgttcgttatgcggaacaactggacatc
ttggatcagattgtcgatgaggttgctcaattgccggctagaaaacctgctcgggatgtt
tga

DBGET integrated database retrieval system