KEGG   Lactobacillus casei Zhang: LCAZH_2094Help
Entry
LCAZH_2094        CDS       T01280                                 

Definition
(RefSeq) phosphoglycerate mutase 1
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCAZH_2094
   01230 Biosynthesis of amino acids
    LCAZH_2094
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCAZH_2094
  Energy metabolism
   00680 Methane metabolism
    LCAZH_2094
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCAZH_2094
Enzymes [BR:lcz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LCAZH_2094
Exosome [BR:lcz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LCAZH_2094
  Exosomal proteins of melanoma cells
   LCAZH_2094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2058293..2058982)
Genome map
AA seq 229 aa AA seqDB search
MAKLVLIRHGQSEWNLSNQFTGWVDVDLSEKGVEEAKHAGQLVKQAGLEFDQAYTSVLTR
AIKTLHYVLEESDQLWIPEMKTWRLNERHYGALQGLNKKETADKYGADQVHIWRRSYDVL
PPLLKATDEGSAAKDRRYADLDPRIIPGGENLKVTLERVIPFWEDHIAPDLLAGKNVIIA
AHGNSLRALTKYIENISDADIMNLEMATGEPVVYDFDEKLNVNSKSKLD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaattagtattgatccgtcacgggcaaagtgaatggaatttgtccaaccaattt
accggctgggtggatgttgatctgagtgaaaagggtgtcgaagaagcaaagcatgctggc
caattggttaagcaagctggtcttgaattcgatcaggcttacacctcagttttgacccgc
gcgatcaagaccctgcattacgtcttggaagaatccgatcaactttggattccagaaatg
aagacatggcgcctgaacgaacgtcactatggcgctttgcaaggcttgaacaagaaggaa
accgctgataaatacggtgccgatcaagttcacatctggcgtcgttcgtatgacgttttg
ccaccattgttgaaagcaactgacgaaggttcagctgctaaggatcgtcgttacgctgat
cttgacccacggatcattcctggcggcgaaaacctgaaagtgaccctcgaacgggttatc
ccattctgggaagatcatattgcaccagatctgttggctggcaagaatgttatcatcgct
gcccacggtaactcactgcgcgccttgaccaagtacatcgaaaacatttccgatgcagac
atcatgaacttggaaatggcgactggcgaacctgttgtttatgacttcgacgaaaagttg
aacgtcaacagtaagagcaagctggactaa

DBGET integrated database retrieval system