KEGG   Lactobacillus casei Zhang: LCAZH_2094Help
Entry
LCAZH_2094        CDS       T01280                                 

Definition
(GenBank) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lcz  Lactobacillus casei Zhang
Pathway
lcz00010  Glycolysis / Gluconeogenesis
lcz00260  Glycine, serine and threonine metabolism
lcz00680  Methane metabolism
lcz01100  Metabolic pathways
lcz01110  Biosynthesis of secondary metabolites
lcz01120  Microbial metabolism in diverse environments
lcz01130  Biosynthesis of antibiotics
lcz01200  Carbon metabolism
lcz01230  Biosynthesis of amino acids
Module
lcz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lcz_M00002  Glycolysis, core module involving three-carbon compounds
lcz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCAZH_2094
  Energy metabolism
   00680 Methane metabolism
    LCAZH_2094
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LCAZH_2094
Enzymes [BR:lcz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LCAZH_2094
Membrane trafficking [BR:lcz04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LCAZH_2094
Exosome [BR:lcz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LCAZH_2094
  Exosomal proteins of melanoma cells
   LCAZH_2094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: ADK19304
Position
complement(2058290..2058979)
Genome map
AA seq 229 aa AA seqDB search
MAKLVLIRHGQSEWNLSNQFTGWVDVDLSEKGVEEAKHAGQLVKQAGLEFDQAYTSVLTR
AIKTLHYVLEESDQLWIPEMKTWRLNERHYGALQGLNKKETADKYGADQVHIWRRSYDVL
PPLLKATDEGSAAKDRRYADLDPRIIPGGENLKVTLERVIPFWEDHIAPDLLAGKNVIIA
AHGNSLRALTKYIENISDADIMNLEMATGEPVVYDFDEKLNVNSKSKLD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaattagtattgatccgtcacgggcaaagtgaatggaatttgtccaaccaattt
accggctgggtggatgttgatctgagtgaaaagggtgtcgaagaagcaaagcatgctggc
caattggttaagcaagctggtcttgaattcgatcaggcttacacctcagttttgacccgc
gcgatcaagaccctgcattacgtcttggaagaatccgatcaactttggattccagaaatg
aagacatggcgcctgaacgaacgtcactatggcgctttgcaaggcttgaacaagaaggaa
accgctgataaatacggtgccgatcaagttcacatctggcgtcgttcgtatgacgttttg
ccaccattgttgaaagcaactgacgaaggttcagctgctaaggatcgtcgttacgctgat
cttgacccacggatcattcctggcggcgaaaacctgaaagtgaccctcgaacgggttatc
ccattctgggaagatcatattgcaccagatctgttggctggcaagaatgttatcatcgct
gcccacggtaactcactgcgcgccttgaccaagtacatcgaaaacatttccgatgcagac
atcatgaacttggaaatggcgactggcgaacctgttgtttatgacttcgacgaaaagttg
aacgtcaacagtaagagcaagctggactaa

DBGET integrated database retrieval system