KEGG   Lactobacillus casei Zhang: LCAZH_2556Help
Entry
LCAZH_2556        CDS       T01280                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase
  KO
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LCAZH_2556
Enzymes [BR:lcz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LCAZH_2556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2501702..2502580)
Genome map
AA seq 292 aa AA seqDB search
MELIEKAPAKINLSLDALYRHDDGEHEWQMVMTSVDLADYVMISPHRSIQVSTDSGFLPE
DPRNLAYKAALALQRHANIRQGARIHIEKHIPVAAGLGGGSSDAAAVLRGLNSLWQLGYS
RSQLARIGLSVDSDVPYCVYSETALVTGRGDVVTPLGSLPNFWVVLAKPRVSVSTPTILN
AIDYDAGLRHPDTQTVVAGIQNHDFAQMTSGMANSLEAITASRYPEMSALKQRLQKYGAE
FAQMSGSGPTVFGLCQKHSRAMRVYNSMKGFCREVYLLRPFCLSATGPRFRG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggaactgatcgaaaaagcaccggccaagattaatctcagcttggatgccttgtatcgc
catgacgacggcgaacatgagtggcagatggtcatgacatcggtcgatttagctgactat
gtgatgattagcccgcatcgcagcattcaggtttcgacagatagcggcttcctacctgaa
gatccgcgcaatctggcctacaaagcagcgttggcgctgcagcgtcacgccaatatccgt
caaggtgcgcggattcatattgaaaaacatattccggtcgccgcggggcttggcggcggc
tcaagtgatgcagctgccgttttgcgagggttgaattcgctttggcaactcggctatagt
cggtcgcaattagcacggatcggcttaagtgttgatagtgatgtcccttactgtgtttat
tcagagacggcgctcgtaactggtcgtggtgatgtggtcaccccacttggcagcttgccg
aatttttgggtcgttttggcaaagcctcgcgtttcagtatcgacgccgaccattttgaat
gccattgattatgacgccggtctgcgccatcctgatacgcaaacggtggtggcaggcatt
caaaatcatgactttgcacaaatgacgagtggcatggcaaatagccttgaagccatcact
gctagtcggtatccggaaatgtccgccctcaagcagcggctacaaaagtatggtgccgaa
ttcgcgcaaatgtcaggcagcggcccaactgtttttggcctgtgccaaaagcactccaga
gccatgcgggtttataacagtatgaagggcttttgccgcgaagtttacctattacggcca
ttttgcttatccgccacgggtccacggtttaggggttga

DBGET integrated database retrieval system