KEGG   Lactobacillus casei Zhang: LCAZH_2627Help
Entry
LCAZH_2627        CDS       T01280                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lcz00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2570271..2571785)
Genome map
AA seq 504 aa AA seqDB search
MADKYMMAIDEGTTSTRAVIVDHAGNMVGEAQKEFTQYFPEPGWVEHDANEIWEAVLSTI
ADTFISTGIQPSQIAGLGITNQRETTVVWDKKTGLPIYHAIVWQSRQTNGIAEQLRKAGH
GDAIHEKTGLLIDAYFSATKIRWILDHVPGAQQRAENGELLFGTIDTWISWKLSGGAIHV
TDYTNASRTMLFNIHTLDWDDDILQLLNIPRAILPEVHSNSEIYGEGAAYHFFGSAVPIA
GMAGDQQSALFGQLALAPGMVKNTYGTGSFIVMNTGEKPTMSANNLLTTIAYGIDGKINY
ALEGSVFVAGSAIQWLRDQMGLVAKSPDTEAAANASTSNDEVYVVPAFTGLGAPYWDAEA
RGAVFGLTRGTTKTDFIKATLQALAYQTRDVVDTMYKDTQIAVPTLRVDGGAAKNDYLMQ
FQADILGKPLERAANLETTAMGAAFLAGLAVGFWQDTDELKKIFKIGKRFEPQMSEARRE
NLYAGWQQAVAATQLFKHRPLPKA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaagtatatgatggcaatcgacgaaggaaccaccagcacgcgggcagttatc
gttgatcacgccggcaacatggtaggtgaggcgcaaaaagaatttacccaatattttcct
gaacctggttgggttgagcatgatgctaatgaaatttgggaagccgtgttgtcaacgatc
gcagacaccttcatttcgaccgggattcagcctagtcaaattgccggacttgggatcacg
aatcaacgtgaaacaacggtggtctgggataaaaagactggtttgccgatttatcacgcg
attgtctggcagtcacggcaaacgaatggcattgctgaacagttgcgcaaagcggggcat
ggggatgccattcatgagaaaaccggtctcttgattgatgcctatttttctgcgactaaa
attcgttggattttggatcatgttcccggtgcccagcagcgcgcagaaaatggcgagtta
ttgtttggcacgatcgatacgtggataagctggaagttgtctggtggcgctattcacgtg
actgattatacgaacgcaagtcgaaccatgttgtttaacattcatacgttggattgggat
gacgacatcctgcaactgctgaatattccgcgcgcgatcctgcctgaagtgcacagtaac
tccgaaatatacggcgaaggggcggcttatcacttctttggcagtgctgtgccgattgca
gggatggccggcgatcagcagagtgcacttttcggtcagttggcgctggcacccggtatg
gttaagaatacttatggcaccggctcatttattgtcatgaacaccggtgaaaaaccaacc
atgtccgcgaacaatttgctgacaacgattgcgtatggcattgacggcaaaattaattac
gcacttgaaggctcggtgtttgtcgccggttcagcgattcagtggctgcgtgatcaaatg
gggttggttgcaaagtcaccagatacggaggcggccgccaatgcgtcaaccagtaatgat
gaagtctatgtggtgcccgccttcacaggtttgggggcgccatattgggatgctgaagcc
cgcggtgcggttttcgggctgacacgcggcacgacgaaaaccgatttcatcaaggcgact
ttgcaggcactagcctatcaaacgcgcgacgtggtcgatactatgtacaaggatacccaa
atcgctgtccccaccttgcgtgttgacggtggtgctgctaaaaatgattacttgatgcaa
ttccaagccgatattttaggtaagccgttggaacgagcggcaaatttggaaacaacggca
atgggcgccgcttttctggccggattagcggttggcttctggcaagatacggatgaactc
aaaaagattttcaagatcggcaagcggtttgaaccgcagatgtcagaagcccggcgcgag
aatttatacgctggctggcaacaagcggtcgctgcaacacagttgtttaaacatcggcca
ctgccaaaagcgtag

DBGET integrated database retrieval system