KEGG   Lactobacillus casei Zhang: LCAZH_2645Help
Entry
LCAZH_2645        CDS       T01280                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LCAZH_2645
Enzymes [BR:lcz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     LCAZH_2645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2590078..2590806)
Genome map
AA seq 242 aa AA seqDB search
MTEQYVFENERKDLAEVAREMFMRKNTNVAGGNISVRITPDKDFDYGDIHIKAGKDYLIM
TPTMMSEAWYAKLQPTQILVVDLETGKLIDGVGRLTREINMHEEAYRANDKIRCVYHSHA
EESMFWATAGLDMPNVTEVTEEVGPIRVLPYAPACSKELADTVYNGLKEVGDAAKEHIFL
LNSHGVLITSEDLHHATEILETVEWNAKIAYQQTVFMKLGLLESYQSCGKTTDGMLKEPL
KA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacaatatgtctttgaaaatgagcggaaagatttagctgaagtggcccgcgaa
atgttcatgcggaagaataccaatgttgcaggtggcaacattagcgttcggatcacccct
gacaaggattttgattacggggatattcatattaaagctggcaaagattatctgattatg
acgccaaccatgatgtctgaagcctggtatgccaagttgcaaccaacccaaattttggtg
gttgatcttgaaaccggcaaactgattgacggcgttggtcgtctgacccgtgaaatcaac
atgcatgaagaagcttatcgggccaacgacaagatccgttgtgtctatcattcccatgct
gaagaatccatgttctgggcaacagccggattggatatgccaaatgtcaccgaagttact
gaagaagttggtccgattcgggtgctgccatacgcaccagcctgctccaaggaacttgca
gacacggtctacaatggcctgaaggaagtcggagatgcggcaaaagagcacatcttcctc
ttaaacagccatggcgttttgatcacttccgaagacttgcatcatgccacagaaattctg
gaaaccgttgaatggaatgcgaagattgcctatcaacagacggtcttcatgaaactggga
ttgttagaaagctatcagtcctgcggtaaaacaactgatggcatgttgaaggaacctttg
aaagcctag

DBGET integrated database retrieval system