KEGG   Lactobacillus casei Zhang: LCAZH_2697Help
Entry
LCAZH_2697        CDS       T01280                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lcz  Lactobacillus casei Zhang
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lcz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LCAZH_2697
   01230 Biosynthesis of amino acids
    LCAZH_2697
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCAZH_2697
   00051 Fructose and mannose metabolism
    LCAZH_2697
   00562 Inositol phosphate metabolism
    LCAZH_2697
Enzymes [BR:lcz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LCAZH_2697
Exosome [BR:lcz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LCAZH_2697
  Exosomal proteins of bladder cancer cells
   LCAZH_2697
  Exosomal proteins of melanoma cells
   LCAZH_2697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2641580..2642272)
Genome map
AA seq 230 aa AA seqDB search
MASVKKPFFIVNPKSYLYGDDAVKLAKIADEIAAEKHLDCLFTGQLIDLPRIKAATSHLI
ITAQHMDPLLPGRGMGHVLPEALKAADVEAVVLNHAENPLEIGVLDKTITRAKAVGLMTV
VCSDTPSESRAIASLHPTMMICEPTSLIGTGSISNDDYIKATNDAVRSVDPDILIMQAAG
VSTGADVKKVLALGADGTGGTSGIINAPDWRAKLMEMMGAMAAYKEAQLA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgttaagaaaccttttttcattgtgaatcctaagtcgtatctttatggtgat
gatgccgtgaagctggcaaaaattgcggatgagattgctgccgaaaagcatcttgactgt
ttatttacggggcaactgattgatctgccacggatcaaggcggcaacgagccacttgatc
atcacggcacagcacatggacccgctgcttcccggccgtggcatgggccatgttttacct
gaagccctgaaagctgcggatgttgaagcggttgtgctgaatcatgctgaaaatccgctg
gaaatcggtgttttggataagacgattacccgtgctaaagcggtcggtttaatgacagtt
gtctgttccgatacgccttctgaaagtcgcgcgattgcgagtctgcacccaaccatgatg
atttgcgaaccaaccagtttaattgggaccggaagtatcagcaatgatgactatattaaa
gcgaccaatgatgccgttcgcagtgtcgatcctgatattttgatcatgcaagcagctggt
gtcagcactggcgcagatgtcaagaaggtattggcattgggcgctgatggaactggcggc
acaagcggtattattaatgcccctgattggcgggcaaaattgatggaaatgatgggtgca
atggcagcatacaaggaggcacagttagcatga

DBGET integrated database retrieval system