KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb0096Help
Entry
Ldb0096           CDS       T00364                                 

Gene name
rtpR
Definition
(GenBank) Ribonucleoside-triphosphate reductase
  KO
K00527  
ribonucleoside-triphosphate reductase (thioredoxin) [EC:1.17.4.2]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ldb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Ldb0096 (rtpR)
   00240 Pyrimidine metabolism
    Ldb0096 (rtpR)
Enzymes [BR:ldb01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.2  ribonucleoside-triphosphate reductase (thioredoxin)
     Ldb0096 (rtpR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
75459..77678
Genome map
AA seq 739 aa AA seqDB search
MSEGISLSAEFIDRVKASVKPHWGKLGWVTYKRTYARWLPEKGRSENWDETVKRVVEGNI
NLDPRLQDSPSLELKQSLTEEAERLYKLIYGLGATPSGRNLWISGTDYQRRTGDSLNNCW
FVAIRPQKYGDSKIVPSYLGKQEKAVSMPFSFLFDELMKGGGVGFSVARSNISQIPRVDF
AIDLQVVVDESSESYDASVKVGAVGKNELVQDADSIYYRLPDTREGWVLANALLIDLHFA
QTNPDRKQKLILDLSDIRPYGAEIHGFGGTASGPMPLISMLLDINEVLNNKAGGRLTSVD
AADICNLIGKAVVAGNVRRSAELALGSNDDQDFISMKQDQEKLMHHRWASNNSVAVDSAF
SGYQPIAAGIRENGEPGIVNLDLSKNYGRIVDGYQAGIDGDVEGTNPCGEISLANGEPCN
LFEVFPLIAEEQGWDLQEVFALAARYAKRVTFSPYDWEISREIIQKNRRIGISMSGIQDW
LLTRLGNRVVTGFKDDFDPETHEAIKVPVYDKRAIKMVDQLYKAVVKADQDYSKTLGCNE
SIKHTTVKPSGTVAKLAGASEGMHFHYGAYLIQRIRFQNSDPLLPALKACGYRTEADIYT
ENTTCVEFPVKAVGADNPNFASAGTVSIAEQFATQAFLQTYWSDNAVSCTITFQDSEGDQ
VESLLRQYRFIIKSTSLLPYFGGSLQQAPKEPIDKETYEKRSQEITGNVEEVFSQLNSDV
KDLELVDQTDCEGGACPIK
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaggaatatctctctcggcggaatttatcgaccgggtgaaagcgagtgtaaaa
cctcactggggcaagctgggctgggtcacctacaagcggacctatgcccgctggctgccg
gaaaagggacggagtgaaaactgggatgaaaccgtcaagcgggtggttgaaggcaacatt
aacctggatccccgccttcaagactccccaagtttggaactgaagcagagcttgactgaa
gaagcagagcggctctacaagctgatctacggcctgggcgcgacgccatctggccggaac
ttgtggatttccgggactgactaccagagacggaccggggattccttgaacaactgctgg
tttgtggccatccgtccgcaaaagtacggggacagcaagatcgtgcccagctaccttggc
aagcaggaaaaggccgtttccatgcctttctctttcctctttgacgaactgatgaagggg
ggcggggttggcttctcagttgccagatccaacatcagccagattccccgggtcgacttt
gccatcgacctgcaggtggtggtcgatgagagcagtgaatcctacgacgcttccgtcaag
gtcggggccgtcggcaagaatgaattagttcaagatgctgacagcatctactaccgcctg
ccggacacccgggagggctgggttttggccaatgccctcttgattgacctccactttgcc
cagaccaacccggaccgtaagcaaaagctgatcctggacttgtccgacatccgtccttac
ggggcagaaatccatggcttcggcggcacggcttccggcccaatgcccttgatctccatg
ctgctggacattaatgaagtcttgaataataaggctggcggccgccttacgtctgttgat
gccgccgacatctgcaacttgatcggcaaggcagtcgtggccggcaatgtccgccggtca
gcggaactggccctgggctcaaatgatgaccaggacttcatttctatgaagcaggaccaa
gagaagctgatgcaccaccgctgggcatccaacaacagcgtggcagttgattcagccttc
agcggctaccagccgatcgctgccgggatccgggaaaacggggagccagggatcgtgaac
ctggacctgtccaagaactatggccggattgttgatggctaccaggctggaattgacggg
gacgtggaagggaccaacccttgcggggagatctccctggccaacggggaaccttgcaac
ctctttgaagtcttcccgctgatcgcggaagaacagggctgggatttgcaggaagttttt
gccttagcggcccgctacgccaagcgggtaaccttcagtccttatgactgggaaatttcc
cgggaaataattcaaaagaaccgccggatcgggatctccatgtccgggatccaggactgg
cttttgaccagactgggcaaccgggtggttaccggcttcaaggatgactttgacccggaa
acccatgaagctatcaaggtgccagtctacgacaagcgggccattaagatggttgaccag
ctttacaaggccgtggtcaaggctgaccaggactacagcaagactttgggctgcaatgaa
tcaatcaagcataccacggtcaagccatcaggcacggtggccaagttggccggtgccagt
gaaggcatgcacttccactacggggcttacttgatccagcggatccgtttccagaattct
gacccgcttttgccagccttgaaggcctgcggctaccggacggaagccgacatctacacg
gaaaacacgacctgcgtggaattcccggtcaaggcggtaggggcggacaaccctaacttt
gcctcagctggcacggtttcaatcgcggaacagtttgccacccaggccttcttgcagact
tattggtcggacaacgcggtttcctgcacgattactttccaggattccgaaggtgaccag
gttgaatccttgctccgccagtaccgctttatcatcaagtcaacctcgcttctgccatac
tttggcggttccctgcagcaagcgccaaaggaaccgatcgataaggagacttacgaaaag
cgcagccaggaaattaccggcaacgtggaagaagtcttcagccagctgaacagcgacgtc
aaggacctggaactggtcgaccagaccgactgtgaaggcggcgcctgcccaattaagtaa

DBGET integrated database retrieval system