KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb0247Help
Entry
Ldb0247           CDS       T00364                                 

Gene name
folKE
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3 3.5.4.16)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ldb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ldb0247 (folKE)
Enzymes [BR:ldb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Ldb0247 (folKE)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Ldb0247 (folKE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
210545..211618
Genome map
AA seq 357 aa AA seqDB search
MMENVILSLGSNIGNREAYINKAVALLGNDPAILIDKASSFYETSPVGNVNQRAFINIAL
KIATTDSPEDLLTKIHQIELHLHRTRDVHWGPRTLDVDIIFWGDQKIKTESLIIPHPEAF
NRLFVLVPTLGIVTPEFPFYNQIKAQIQKLQKADQTIQLVQKQTQSKQVVESAIRQILNA
IGDDPDRPGLVETPDRVARMYNEIFSSEGLDNFEDYKLFNTKETDNSKMVMVKNITFYSM
CEHHMMPFWGKAHIAYVPDHGKIIGLSKIPRLVDFVSHKLGLQEKLTDDIVAQMNRILAP
KGVAVIVDSRHMCVEMRGVKKADSLTRTIRFSGVFETDQALRMAFLNSIGDVNGKTI
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaaatgtcattttaagtttaggtagtaatatcggtaatcgtgaagcctatatt
aacaaagccgttgcgctgttgggaaacgacccggctattttgattgataaagcttcaagt
ttttatgaaacttcaccggttggtaatgtgaaccagcgggcctttataaatattgcgctt
aaaatcgcaacaactgattcaccggaagacttgttaaccaaaatccaccaaatcgaattg
catttgcaccggacccgtgatgtacattggggaccgcggacattggatgttgatattatt
ttttggggtgatcaaaagattaagactgagtcgctgattattccgcatccggaagcattc
aaccgtttatttgtgctggtaccaacactgggaatcgtgacacctgaatttccattttat
aatcaaattaaggctcaaattcaaaaacttcaaaaagcagatcaaacaattcaacttgta
caaaagcagacgcaatctaaacaagtcgttgaaagcgcaattcgtcaaatcctgaatgcg
atcggagatgatccggatcgaccaggactggtggagacaccggatcgcgtcgcccggatg
tataatgaaattttttcgtctgaggggttggataattttgaagactataaattgtttaat
accaaagagactgataattcaaaaatggtgatggtgaaaaacattacgttttattcaatg
tgtgagcaccacatgatgccgttttgggggaaagcccacattgcttacgtacctgatcac
gggaaaattattggcttaagtaaaatcccgagactggttgattttgtatcacacaagttg
ggccttcaagagaagctgactgatgatattgttgcccaaatgaaccgaattctggcaccc
aagggagtggcggttattgttgactcccggcacatgtgtgttgaaatgcggggagttaaa
aaggctgattcattaactcggacgattcgtttttctggtgtttttgagaccgaccaggcg
ttaagaatggcatttttaaactcgataggtgatgttaatgggaaaacaatctga

DBGET integrated database retrieval system