KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb0249Help
Entry
Ldb0249           CDS       T00364                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ldb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
212920..214020
Genome map
AA seq 366 aa AA seqDB search
MSIMEIKKINNRQQTFSGNVTISFNANTEELPKLINLLADQTANLSISSSLVIATFTQTE
LAAVIKSWPEVFGAENGTLQQIQAASQIHFKGRGFDFDITTKPIIYSILNLTPDSFYDGG
RNASVDGVLKRIEADLAAGTAIFEVGGKSSKPHFDDISAEEEWGRIKPFLDAIHKRFPNI
VLAIDSNTNAVIEEALKNGIQIINDIDGFNSQAKLNLVAKYKPAVVTMFNGRNFNEQTET
LSKTMMDFFTHTISDLTGVGLEKENIVIDPGVGFSDHNTLAFDLIKMKLTKLMAEFQTPI
MIAISRKSFAKRLFNLESADDRLIPTLLFEAFMTVLGGRVIRVHDAKETRQLIDAFELLK
DQLLLK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgagcataatggaaattaaaaaaataaacaatcgtcaacaaacatttagcggcaacgtc
accatttcttttaatgcgaatacagaagaattacccaaattaattaatctgttagctgac
cagactgccaatctttcgatttcgtcatcgctagtcatcgcgacatttacgcaaacggaa
ttggcagctgtaattaaaagttggccagaagtgtttggcgctgaaaacggtacgctgcag
caaatccaggcagcttctcaaatccattttaagggtcggggatttgactttgatattacg
accaaaccaattatttattcgattttaaacttgacgccggattcattttacgatggtggg
agaaacgcttcagtcgatggggttctgaaacgaattgaagcagacctggcagccggaact
gccatctttgaagtcggtggcaaatcttccaagccacactttgatgatattagtgctgaa
gaggagtgggggcgaattaaaccgtttttggacgctattcacaagcgttttccaaatatt
gttttggcaattgattccaatacaaacgcggttattgaagaagcactaaaaaatggtatt
caaattattaacgacatcgatggctttaattctcaagcaaaactgaatttagttgctaaa
tacaaacctgctgttgtaacgatgtttaatggtcggaacttcaatgagcaaacggaaacc
ttatcaaaaacaatgatggatttctttacacatacaattagcgatttaacaggcgttggg
cttgaaaaagaaaacattgtgattgacccgggcgttggcttttctgatcataatacgtta
gcttttgatctgattaagatgaaattaacgaaattaatggcagaatttcaaacaccgatt
atgattgcaatttcgcgaaaaagttttgctaaacggctgtttaatttggaatcagcggat
gatcgattgattccaacgctgctatttgaagcatttatgacggttcttggcggtcgggtt
attcgggtacatgatgcaaaagaaactcgtcagctaatcgatgcttttgagttgctaaaa
gatcagctattgctaaagtaa

DBGET integrated database retrieval system