KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb0534Help
Entry
Ldb0534           CDS       T00364                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ldb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ldb0534
Enzymes [BR:ldb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Ldb0534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
449229..451631
Genome map
AA seq 800 aa AA seqDB search
MTADYDSKEYLKSVDAWWRAANYLSVGQLFLLKNPLLKEELTADDVKIKPVGHWGTIAPQ
NFIYAHLNRVIKKYDLNMFYIEGSGHGGQVMVSNSYLDGSYSEIYPEISQDEAGMTKLFK
RFSFPGGVASHAAPETPGSIHEGGELGYTLSHATGAILDNPDVIAAAEIGDGEAETGPLA
AGWFSNRFIDPVKDGAVLPILQVNGFKISNPTITARMSDEELTKYFEGMGWKPYFVSTFK
GGRFDGMKDIDQIHEEMAKTLDAIIEDIKAIQKNARENGDKSFAHWPLLIFQCPKGWTGP
KTDLDGNPIENSFRAHQIPLPVDQKHMDHKELLLDWLKSYKPEELFDETGYPTDLVLQNA
VHGDQRMAMNPVTNGGINPKRLNLPDWRDFAFEVGKPGSKDAQDMVEWAKYLTKVAELNP
TTFRGFGPDESKSNRLFDFLDSEKRQWESEIHEPNDENLAAQGRLIDSQLSEHQDEGMLE
GYVLTGRHGFFATYEAFGRVVDSMLTQHMKWLRKAKEQYWRRDYPSLNFVATSTVFQQDH
NGYTHQDPGLLTHLFEKNRPDMIHEYLPADTNTLLAVADKAFRDREGINLLVTSKQERPQ
WFTPEEAAKLVDKGLGYIDWASTDKDAKPDVVFASTETEPTMETLAAIDILHQNFPDLKI
RYINVVDVMKLMAPKDNPAAISQEEFDRLFPTDVPTIFAWHGYKTMMESIWFARKRYNVS
IHCYEENGDITTAFDMRVLNHLDRFDLAKDAVEQIPALKDKSAAFIDKMDSLLSKHHAYI
RDHGEDIPEVTSWKWTGLDK
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagattacgattcaaaagaatacttaaagagcgtcgacgcttggtggcgggcc
gccaactacttgtcagtcggccagttgttcctgctcaagaaccccttgcttaaggaagaa
ctgacggcagacgacgtcaagatcaagccggttggccactggggcacgatcgcgccgcag
aactttatctacgcccacttaaaccgggttatcaagaagtatgacttgaacatgttctac
atcgaaggttccggtcacggcggccaggtgatggtttccaactcatacctggacgggtct
tactctgaaatctacccggaaatcagccaagacgaagccgggatgaccaagctcttcaag
cgcttcagcttcccgggcggggtagcttcccacgcggctccggaaaccccgggttcaatc
catgaaggcggggaactgggctacactttgtcgcacgcgactggcgcgattctggacaac
ccggacgtgattgccgccgctgaaattggtgacggggaagctgaaaccggcccgctggct
gctggctggttctccaaccgcttcatcgacccggtcaaggacggggctgtcttgccaatc
ctgcaggttaacggctttaagatttccaacccaaccattactgcccgcatgagcgatgaa
gaactgactaagtactttgaaggcatgggctggaagccttactttgtttcaactttcaag
ggcggccgctttgacgggatgaaggatattgaccagatccatgaggaaatggccaagacc
ctggatgccatcattgaagacatcaaggctattcaaaagaatgcccgtgaaaacggcgat
aaatcatttgcccactggccgctcttgatcttccaatgcccgaagggttggactggtcct
aagaccgatttggacggcaacccaattgaaaactccttccgggcccaccagattccgctt
ccggttgaccagaagcacatggaccacaaggaactgttgctggactggctgaagagctac
aagccggaagaactgtttgacgaaaccggctacccgactgacttagtcctgcaaaacgcg
gttcatggtgaccaaagaatggctatgaacccagtaactaacggggggatcaatcctaag
cgcttgaatctgccagactggcgcgactttgcctttgaagttggcaagccgggctccaag
gacgcccaggatatggtggaatgggccaagtacctgaccaaggtggcagaactgaacccg
actactttccggggctttggcccggacgaatccaagtccaaccgcttgtttgacttcctg
gacagcgaaaagcggcaatgggaaagtgaaatccacgaaccaaacgatgaaaacctggcc
gcgcaaggccgtttgattgactcacaattgtcagagcaccaagatgaagggatgctggaa
ggctacgttttgactggccgccacggcttcttcgctacttacgaagcctttggccgggtg
gttgactccatgctgacccagcacatgaagtggctgcggaaggctaaggaacaatactgg
cgccgcgattacccatcattgaactttgtagctacgtcaactgtcttccagcaggaccac
aacggctacacccaccaggatccaggtcttttgacccatttgtttgaaaagaaccggccg
gacatgattcatgaatacctgccagctgacaccaacactttgttggctgtagctgataag
gccttccgtgaccgggaagggatcaacctgctggtaacttccaagcaggaacggccgcaa
tggttcactcctgaagaagctgccaagctggttgacaagggcctgggctacatcgactgg
gcttcaactgacaaggatgccaagccggacgtggtcttcgcttcaactgaaactgaaccg
accatggaaaccctggcagcgatcgacatcctgcaccagaacttcccagacttgaagatc
cgctacatcaatgtggttgacgtgatgaagctgatggcgccaaaggataacccagctgct
atttcccaagaggaattcgaccgcctcttcccaactgacgtgccaaccatttttgcatgg
catggctacaagaccatgatggaatccatctggtttgcccgcaagcgttacaacgtttca
attcactgctatgaagaaaatggtgacattaccacggcatttgacatgcgggtcttgaac
caccttgaccgtttcgacctggccaaggacgcggttgaacaaatcccagccttgaaggac
aagagtgctgccttcatcgacaagatggacagcctgctgtctaagcaccacgcttacatc
cgggaccacggtgaagacattccagaagtaacttcttggaagtggactggcctggacaag
taa

DBGET integrated database retrieval system