KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb0558Help
Entry
Ldb0558           CDS       T00364                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
ldb00040  Pentose and glucuronate interconversions
ldb00052  Galactose metabolism
ldb00500  Starch and sucrose metabolism
ldb00520  Amino sugar and nucleotide sugar metabolism
ldb01100  Metabolic pathways
ldb01130  Biosynthesis of antibiotics
Module
ldb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ldb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ldb0558 (galU)
   00052 Galactose metabolism
    Ldb0558 (galU)
   00500 Starch and sucrose metabolism
    Ldb0558 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Ldb0558 (galU)
Enzymes [BR:ldb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Ldb0558 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: CAI97388
UniProt: Q1GB86
Position
473107..474021
Genome map
AA seq 304 aa AA seqDB search
MKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQFIVEEAMASGIEDILIITGRSK
RAIEDHFDSNTELEDNLTEKHKDALLKLARETTMSNIKVNLYFTRQPHPNGLGDAVNRAR
SFIAGEPFVVMLGDDLMRDKTPLTKQLIDCYHETHASTIAVMKVPNEEVNKYGVIDPIGE
TAPDLYNVKAFVEKPDVDKAPSDLAIIGRYLLTPEIFDMLDKQKAGAGGEIQLTDAIDAL
NKTQRVFAHEFKGQRFDVGNKEGYMETSIQYGLRHPETKDALRKYIIDLGKKLESEGKKK
PAGK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcagaaaagcgatcatcccagctgccggtttgggaaccagatttttgccagca
accaaggccatgcctaaggaaatgctgccaatcgttgacaagccaactattcaatttatc
gttgaagaagccatggcttcagggattgaagacattctgatcattactggcagaagcaag
cgggcaatcgaagaccacttcgactcaaacacggaactagaagacaacttgactgaaaag
cacaaggacgcgcttttgaagctggcccgggaaaccaccatgtccaacataaaggttaac
ctttacttcacccggcagccgcatccaaatggcttgggggatgccgtcaaccgggctcgc
agctttatcgccggtgaacctttcgtggttatgctaggcgacgacttgatgagagacaag
acgccattgaccaagcaattgatcgactgctaccatgaaactcacgcttcaaccatcgcg
gttatgaaggtaccgaatgaagaagtcaacaagtacggtgtcatcgacccaatcggcgaa
actgctccggacctgtacaacgttaaggcctttgtggaaaagccagacgttgacaaggcc
ccaagtgacctggccatcatcggccgctacctgctgactccggaaatttttgacatgctg
gacaagcaaaaggccggtgccggcggtgaaatccaattgactgacgccatcgacgccttg
aacaagacccagcgggtcttcgcccacgaattcaagggccagcgttttgacgtcggcaac
aaggaaggctacatggaaacttccatccaatacggtctccgtcacccggaaaccaaggat
gctttgcgcaagtacatcattgacttgggcaagaagctggaaagcgaaggcaagaagaag
ccagccggcaagtga

DBGET integrated database retrieval system