KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb0558Help
Entry
Ldb0558           CDS       T00364                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ldb00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ldb00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ldb00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ldb00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
473107..474021
Genome map
AA seq 304 aa AA seqDB search
MKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQFIVEEAMASGIEDILIITGRSK
RAIEDHFDSNTELEDNLTEKHKDALLKLARETTMSNIKVNLYFTRQPHPNGLGDAVNRAR
SFIAGEPFVVMLGDDLMRDKTPLTKQLIDCYHETHASTIAVMKVPNEEVNKYGVIDPIGE
TAPDLYNVKAFVEKPDVDKAPSDLAIIGRYLLTPEIFDMLDKQKAGAGGEIQLTDAIDAL
NKTQRVFAHEFKGQRFDVGNKEGYMETSIQYGLRHPETKDALRKYIIDLGKKLESEGKKK
PAGK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcagaaaagcgatcatcccagctgccggtttgggaaccagatttttgccagca
accaaggccatgcctaaggaaatgctgccaatcgttgacaagccaactattcaatttatc
gttgaagaagccatggcttcagggattgaagacattctgatcattactggcagaagcaag
cgggcaatcgaagaccacttcgactcaaacacggaactagaagacaacttgactgaaaag
cacaaggacgcgcttttgaagctggcccgggaaaccaccatgtccaacataaaggttaac
ctttacttcacccggcagccgcatccaaatggcttgggggatgccgtcaaccgggctcgc
agctttatcgccggtgaacctttcgtggttatgctaggcgacgacttgatgagagacaag
acgccattgaccaagcaattgatcgactgctaccatgaaactcacgcttcaaccatcgcg
gttatgaaggtaccgaatgaagaagtcaacaagtacggtgtcatcgacccaatcggcgaa
actgctccggacctgtacaacgttaaggcctttgtggaaaagccagacgttgacaaggcc
ccaagtgacctggccatcatcggccgctacctgctgactccggaaatttttgacatgctg
gacaagcaaaaggccggtgccggcggtgaaatccaattgactgacgccatcgacgccttg
aacaagacccagcgggtcttcgcccacgaattcaagggccagcgttttgacgtcggcaac
aaggaaggctacatggaaacttccatccaatacggtctccgtcacccggaaaccaaggat
gctttgcgcaagtacatcattgacttgggcaagaagctggaaagcgaaggcaagaagaag
ccagccggcaagtga

DBGET integrated database retrieval system