KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb0637Help
Entry
Ldb0637           CDS       T00364                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ldb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ldb0637 (tpiA)
   01230 Biosynthesis of amino acids
    Ldb0637 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ldb0637 (tpiA)
   00051 Fructose and mannose metabolism
    Ldb0637 (tpiA)
   00562 Inositol phosphate metabolism
    Ldb0637 (tpiA)
Enzymes [BR:ldb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ldb0637 (tpiA)
Exosome [BR:ldb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ldb0637 (tpiA)
  Exosomal proteins of bladder cancer cells
   Ldb0637 (tpiA)
  Exosomal proteins of melanoma cells
   Ldb0637 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
542958..543716
Genome map
AA seq 252 aa AA seqDB search
MSRTPIIAGNWKLNMNPKETVEFVNAVKDQLPDPSKVESVICAPAVDLDALLKAAEGSNL
HVGAENCYWENSGAFTGETSPAVLKEMGVQYVIIGHSERRDYFHETDEDINKKAKAIFAN
GLTPILCCGESLETREAGKENEWVVSQIKAGLEGLTSEQVSKLVIAYEPIWAIGTGKTAS
SDQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKELMAKPNIDGGLVGGASLV
PDSYLALVNYQD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaccccaattattgctggtaactggaagctgaacatgaacccaaaggaaact
gttgagttcgtaaacgctgttaaggaccaattgccagacccatcaaaggttgaatcagtg
atttgtgcaccagcagttgacttggacgccttgctgaaggctgccgaaggctcaaacctg
cacgtcggtgcagaaaactgctactgggaaaactccggtgccttcactggtgaaacttct
ccagcagttttgaaggaaatgggcgtgcaatacgtcatcatcggccactcagaacgccgt
gactacttccacgaaactgacgaagacatcaacaagaaggccaaggctatctttgccaac
ggcttgactccaatcctttgctgcggtgaatcactggaaacccgggaagccggcaaggaa
aacgaatgggttgtcagccaaatcaaggctggcctggaaggcttgactagtgaacaagtt
tccaagctggtgatcgcttacgaaccaatctgggcgatcggcactggcaagactgcttca
agcgaccaagctgaagaaatgtgcaagactatccgggaaactgttaaggacttgtacaac
gaagaaactgctgaaaacgtccgcatccaatacggcggttcagtaaagccagccaacgtc
aaggaattgatggctaagccaaacatcgacggtggcttggttggtggtgcatcattggta
ccagactcatacctggctttggtaaactaccaagactaa

DBGET integrated database retrieval system