KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb0699Help
Entry
Ldb0699           CDS       T00364                                 

Gene name
murE2
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ldb00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Ldb0699 (murE2)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ldb0699 (murE2)
Enzymes [BR:ldb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Ldb0699 (murE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(592304..593659)
Genome map
AA seq 451 aa AA seqDB search
MSFKSNIATFAGKSSYWFLHNVLKGGTSFPGKLAMKLDPDVLEQLGKDYETIIVTGTNGK
TMTTALITQTLKEKYGDILTNPSGSNMAQGIVTAFLAHDQKKSSRKLAVLEVDEANVKAV
TQLVHPKAFVLTNIFRDQMDRYGEIYTTYEKIVAGIKLAPDATIIANGDASIFSSVDLPN
PKVFFGFETDQDKPQNDLKADVNTDGVLCPKCEHILHYHAISYANLGDFFCPNCGYKRPD
LTYKLEEISEQTPSRIKFTIEGKEFAVNIGGTYNIYNALAAFACAREFGVSANEIAAAFA
KNKRIFGRQELIHYQGKQINIILVKNPVGLNEVLSLLDTEKDHYSLAALLNAHHADGIDT
SWIWDGNFESLDRDKIDQVIVGGERHKDMAFRLEVAGFDPDKMIIESDFDQLLAAFAKTP
TDKIYILSTYTAMLHLRQVFADKGVLKRRIN
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaaatccaacatcgcaacttttgccggcaagtcctcttactggttcttgcac
aatgtcttaaagggcgggaccagctttcccggcaagctggccatgaagcttgacccagat
gtccttgagcagctgggcaaggactacgagaccattatcgttacggggaccaacggcaag
accatgaccacggccctcatcacccagaccttgaaagaaaaatacggcgatattttgacc
aacccgtccgggtccaacatggcccaggggatcgtaactgcctttttggctcatgaccag
aaaaaaagcagccggaaactggccgttttggaagtcgatgaagccaacgtcaaggccgta
acccagttggtccaccccaaggcctttgttctgaccaacattttcagagaccagatggac
cgctacggggagatctacacgacctatgaaaagatcgtcgccggcatcaagctggcgcca
gatgcaaccatcatcgctaacggggacgccagcatcttctcttcagtcgacctgccgaat
ccaaaagtcttttttggctttgaaactgaccaggacaaaccgcaaaatgacctcaaggct
gacgtcaacactgacggggtcctctgccctaagtgcgagcatatcctgcactaccacgca
atttcctatgccaacctgggtgacttcttctgcccgaactgcggctacaagcggccggat
ttgacctacaagctggaagaaatcagcgagcagaccccgagccggatcaagtttaccatt
gaaggcaaggaattcgccgtcaacatcggcggcacctacaatatctacaatgccctggcc
gcctttgcctgcgccagagaattcggcgtttccgccaatgaaatcgcggcggcttttgcc
aaaaacaagcggatcttcggtcgccaggaactgattcactaccagggcaagcagatcaac
atcatcttggtcaagaacccggttggcttaaacgaagtcctcagcctcctggacacggaa
aaggaccactacagcctggctgccctcttaaacgcccaccacgctgacggcatcgacacc
agctggatctgggacgggaactttgaaagcctggaccgggacaagatcgatcaggtaatc
gtcggcggcgagcggcacaaggacatggccttccgcctggaagttgccggttttgacccg
gacaagatgatcattgaaagcgactttgaccagctgttggccgcttttgcaaagacgccg
actgacaagatctacattctctcaacctacacggccatgctgcacctgcggcaggtcttt
gccgacaagggcgtcttgaagagaagaatcaactag

DBGET integrated database retrieval system