KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb0699Help
Entry
Ldb0699           CDS       T00364                                 

Gene name
murE2
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ldb00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ldb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(592304..593659)
Genome map
AA seq 451 aa AA seqDB search
MSFKSNIATFAGKSSYWFLHNVLKGGTSFPGKLAMKLDPDVLEQLGKDYETIIVTGTNGK
TMTTALITQTLKEKYGDILTNPSGSNMAQGIVTAFLAHDQKKSSRKLAVLEVDEANVKAV
TQLVHPKAFVLTNIFRDQMDRYGEIYTTYEKIVAGIKLAPDATIIANGDASIFSSVDLPN
PKVFFGFETDQDKPQNDLKADVNTDGVLCPKCEHILHYHAISYANLGDFFCPNCGYKRPD
LTYKLEEISEQTPSRIKFTIEGKEFAVNIGGTYNIYNALAAFACAREFGVSANEIAAAFA
KNKRIFGRQELIHYQGKQINIILVKNPVGLNEVLSLLDTEKDHYSLAALLNAHHADGIDT
SWIWDGNFESLDRDKIDQVIVGGERHKDMAFRLEVAGFDPDKMIIESDFDQLLAAFAKTP
TDKIYILSTYTAMLHLRQVFADKGVLKRRIN
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaaatccaacatcgcaacttttgccggcaagtcctcttactggttcttgcac
aatgtcttaaagggcgggaccagctttcccggcaagctggccatgaagcttgacccagat
gtccttgagcagctgggcaaggactacgagaccattatcgttacggggaccaacggcaag
accatgaccacggccctcatcacccagaccttgaaagaaaaatacggcgatattttgacc
aacccgtccgggtccaacatggcccaggggatcgtaactgcctttttggctcatgaccag
aaaaaaagcagccggaaactggccgttttggaagtcgatgaagccaacgtcaaggccgta
acccagttggtccaccccaaggcctttgttctgaccaacattttcagagaccagatggac
cgctacggggagatctacacgacctatgaaaagatcgtcgccggcatcaagctggcgcca
gatgcaaccatcatcgctaacggggacgccagcatcttctcttcagtcgacctgccgaat
ccaaaagtcttttttggctttgaaactgaccaggacaaaccgcaaaatgacctcaaggct
gacgtcaacactgacggggtcctctgccctaagtgcgagcatatcctgcactaccacgca
atttcctatgccaacctgggtgacttcttctgcccgaactgcggctacaagcggccggat
ttgacctacaagctggaagaaatcagcgagcagaccccgagccggatcaagtttaccatt
gaaggcaaggaattcgccgtcaacatcggcggcacctacaatatctacaatgccctggcc
gcctttgcctgcgccagagaattcggcgtttccgccaatgaaatcgcggcggcttttgcc
aaaaacaagcggatcttcggtcgccaggaactgattcactaccagggcaagcagatcaac
atcatcttggtcaagaacccggttggcttaaacgaagtcctcagcctcctggacacggaa
aaggaccactacagcctggctgccctcttaaacgcccaccacgctgacggcatcgacacc
agctggatctgggacgggaactttgaaagcctggaccgggacaagatcgatcaggtaatc
gtcggcggcgagcggcacaaggacatggccttccgcctggaagttgccggttttgacccg
gacaagatgatcattgaaagcgactttgaccagctgttggccgcttttgcaaagacgccg
actgacaagatctacattctctcaacctacacggccatgctgcacctgcggcaggtcttt
gccgacaagggcgtcttgaagagaagaatcaactag

DBGET integrated database retrieval system