KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb0758Help
Entry
Ldb0758           CDS       T00364                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ldb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
647110..649500
Genome map
AA seq 796 aa AA seqDB search
MTEFSGEVKSVIYENAQNMYKILLVAVSQPLAGYDDDEIKVTGTFGDLELGQEYNFTGDL
VTHPKYGLQFQATGCQPALPKETGGVVKYLSSEKFPGIGPKTAEKIVDQLGSGGLKSLQA
DPTLIAKLDLSQKQKDSLLSGLAQMDSFDDLGMTLASYGIPRKVAGRLYQKYHDQTLKKL
QADPYLPLGEVTGYSFKQADHLGIGFGIALDSLERADGSILAVLLQALTMEGETYLELEE
LLPAAKELTNINFDLLAEAVNDLQDKKKVVVEEGRASLLAPFQVESEIVTDLEDLLAKGK
EADYREKDLDQAIKRAERKLGISYDPEQKQAIKNAVTSPVSILTGGPGSGKTTIIDGILL
VLKDLADMDEEEAEEAILLAAPTGRAAKRMEEVTGYPAKTIHRLLGLGIDNSEEMELNDL
EGEILIVDEMSMVDIYLFEKLLSAISNVHHLVFVGDKDQLPSVGAGKVFADLIEADFIPT
CQLQVVHRQKDDSTIIPLAHAVNEGANPAVLLQKTASYSFIPCRPHAVPSAVEQITQAAL
KSGFAADDIQVLGAMYRGDGGINSLNDTLQRVINPEKGNDKAVEAHGENFRLHDRVLQLQ
NDPERGIYNGEIGKVVAVDPEMLEDEDDEVKLLVNFDGNEVAYTQADLNNLTRAYAITIH
KSQGSEFPLVILCLTMQNYIMLKRNLLYTAITRASQKLVMVGEEQAFAQAMRVKGNERRT
NLVWLLKDRFKPEEQSKQESSDSTENTLDKEEKVEDYILTGARISRAEISPMVGMEGLVQ
GCKNLVEIVRTKGPGA
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagtttagcggtgaagtaaagagcgttatttatgaaaatgcgcaaaacatgtac
aagatcttgctggtcgccgtaagtcagcctctggccggctatgacgatgatgaaatcaag
gtgacggggaccttcggggacctggagcttggccaggaatacaactttaccggtgacttg
gtcacccaccccaagtacggcttgcagtttcaagcgactggctgccagccggccctgccg
aaagagactggcggggtggtcaagtacctgtcttctgagaagttccctggcatcgggccc
aagacggcggaaaagatcgttgaccagctgggcagcgggggcttaaagagcttgcaggct
gatccaaccttgatcgccaagctggatctttcccaaaagcaaaaagacagcctcttgtcc
ggcctggctcagatggattcctttgacgacctgggtatgactttggccagttacgggatt
ccccgcaaggtggccggccgactttaccagaagtaccatgaccagaccttgaaaaagctg
caggccgatccctacctgcctttaggcgaagtgaccggctattccttcaagcaggccgat
cacttgggaattggctttggaattgcccttgacagtctggagcgggctgatggcagtatc
ctggcggttttgctccaggccttgaccatggagggggaaacctacctggaactggaagaa
cttttgccagccgccaaggaactgacaaatataaattttgacctcctggcagaagcagtt
aacgacctgcaggacaagaagaaggtcgtcgtggaagaaggccgggccagcctgctggcc
ccatttcaagtggaaagcgagatcgtgaccgacctggaagaccttttagccaagggcaag
gaagcggactaccgggaaaaggacttggaccaggccatcaagcgggccgaaaggaagctg
gggatcagctatgaccctgagcaaaagcaggccatcaaaaacgcggtaaccagtccggtc
tccatcctgactgggggacccgggagcgggaagacgaccatcattgacgggatcttgctg
gtcttaaaggacctggccgacatggacgaagaagaagctgaagaagcgattctcctggcc
gcgccaaccggccgggcagccaagcggatggaggaagtcaccggctatccggccaagacc
atccaccgcctcttgggcctggggatcgacaacagcgaggaaatggagctgaatgatttg
gaaggggagatcttgatcgtcgacgaaatgtccatggtcgatatctacctctttgaaaag
ctgctcagcgccatcagcaatgttcaccacctggtctttgtcggtgacaaggaccaattg
ccatccgtcggggcggggaaggttttcgctgacttaatcgaggcggacttcattccgacc
tgccagttgcaggtggtccaccggcaaaaggacgattcaacgatcattcccctggcccac
gcggtcaacgaaggagccaacccggctgttctcttgcaaaagacggccagctactccttt
attccttgccggccccatgccgtgcctagcgccgtcgagcagatcacccaggcagcctta
aagagtggctttgcggctgacgacatccaggttctgggggccatgtaccgaggcgacggt
gggatcaacagtctgaatgacaccctccagcgggtgatcaacccggaaaagggcaatgat
aaagcagttgaggcccatggtgagaactttcgcctgcatgaccgggtcctgcagctgcaa
aatgacccggagcgggggatctacaacggcgagattggaaaggtcgtggccgttgacccg
gaaatgctggaagacgaggatgacgaagtcaagcttttggtcaattttgacggcaatgaa
gtggcttacacgcaggcggacttgaataacctgacccgggcctatgccatcaccatccac
aagtcccaggggtcagaatttcctttggtcattctctgcttaaccatgcagaactatatc
atgctcaagcgcaatcttttgtatacggccatcacccgggcttcccagaagctggtcatg
gtcggagaagagcaggcttttgcccaggccatgcgggtcaagggcaatgagcggcggacc
aacctggtctggctcttgaaggaccgctttaagccagaagaacaaagtaagcaagagagt
agtgactctacagagaatactctggataaagaagaaaaagtcgaagactacatcttgacc
ggggcccggatcagccgggcggagatttctcccatggttggcatggagggcctggttcag
ggatgcaagaatttggtggaaatcgtccggaccaagggaccaggagcctaa

DBGET integrated database retrieval system