KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb0879Help
Entry
Ldb0879           CDS       T00364                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Benzoate degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:ldb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ldb0879
   00630 Glyoxylate and dicarboxylate metabolism
    Ldb0879
   00640 Propanoate metabolism
    Ldb0879
   00650 Butanoate metabolism
    Ldb0879
  Lipid metabolism
   00071 Fatty acid degradation
    Ldb0879
   00072 Synthesis and degradation of ketone bodies
    Ldb0879
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ldb0879
   00310 Lysine degradation
    Ldb0879
   00380 Tryptophan metabolism
    Ldb0879
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ldb0879
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ldb0879
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ldb0879
Enzymes [BR:ldb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Ldb0879
Exosome [BR:ldb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ldb0879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
769518..770618
Genome map
AA seq 366 aa AA seqDB search
MQDIYIVAAKRTPFGRYHKQLADFSAIDLGQIALRGALKEAGLDAEALDALFMGNVLSAG
LGQNMARQIALNAGMRQDSVAVSINEVCGSSLKAARLAEAQMLIGDLGLVAVGGSESMTN
ASKEIMFSDGLVDSFSGKSMGITAENVAKRNHISRQDADAFSLSSHQKAVKAQAEGLFAD
EIIQIEDLKQDENVRPDTSLEALAGLKTSFLEDGTVTAGNASPISDGASMIILATAEKVA
EYQLTPLAKLGAYAEVGYDPEFMGYGPYYAIRKLLNETGRQVADYDFFEINEAFAATTLA
VARDLEIPLAKVNKQGGAIALGHPLGASGTRLLATAARQLQRGGQRAIASLCIGGGLAIA
FEIEKA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatatttatattgttgcggccaagcgaactccatttggccgttaccacaagcaa
ttggctgacttttctgctatcgacctgggccaaatcgccctgcgcggcgcattaaaagaa
gccggccttgacgccgaagccctggatgccctcttcatgggcaatgtcctgtctgccggc
ttaggccagaacatggcccggcaaattgctttaaacgccgggatgcggcaggactcagtc
gccgtgtccatcaacgaagtctgtggctccagcctcaaggctgcccggctggctgaagcc
caaatgttaatcggtgacctggggctggttgctgtcggcggcagcgagagcatgaccaac
gcctcaaaggaaatcatgttcagcgatggtctcgttgactccttctccggtaaatccatg
ggcattactgccgaaaacgtggctaagcgcaaccacatcagccgccaagacgctgacgcc
ttcagcttgtcctcccaccaaaaagctgtcaaagcacaagctgaaggactttttgccgat
gaaatcattcaaattgaagatctcaagcaagatgaaaacgttcgcccggataccagcctg
gaagccctggccggtcttaaaacttccttccttgaagacgggaccgtcactgccggtaac
gcctccccaatctccgacggggccagcatgatcatcctggctaccgcggaaaaagtcgct
gaataccagctgacgcctttagccaagctgggtgcttacgccgaagtaggctatgacccg
gaattcatgggctatggtccatactatgctatccgtaagctgcttaatgaaactggccgg
caggtagccgattacgacttctttgaaatcaatgaagcctttgccgcaactactttggct
gttgcccgcgacctggaaattcctttagccaaggtcaacaagcagggcggggcgattgct
ttaggccacccgctcggcgcttccggcacccgccttctggctaccgctgcccgccagctg
caaagaggcggccagcgcgctatcgccagcctttgcatcggaggcggcctggccatcgct
tttgaaattgagaaggcataa

DBGET integrated database retrieval system