KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb1614Help
Entry
Ldb1614           CDS       T00364                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ldb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ldb1614 (ruvA)
Enzymes [BR:ldb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Ldb1614 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1386902..1387495)
Genome map
AA seq 197 aa AA seqDB search
MYEYFEGTITVVNPAYVVIEVAGIGYRILTPTPYAYKDGDKARIYVEQVVRENGMTLYGF
KSQQDKVLFNKLNEVSGIGPKSALAIMAAEDNGALASAIESGEVSYLTRFPGIGKKTASQ
IVLDLRGKMGNYVAENLFTEDEPVKSVFPALEDALLALGALGYSQKEVDRIKPKLKKLPE
MSADEYIKQGLGFLLKK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagtattttgagggcaccattaccgtggttaatccggcctatgtcgtgattgaa
gtggccgggatcggctaccggatcctgaccccgaccccttatgcctataaagatggggac
aaggcccggatctacgttgaacaggtcgtccgggaaaacgggatgaccctctacggcttc
aagagccagcaagacaaggtcctcttcaacaagcttaatgaagtttccggtatcggtcct
aagtctgccctggccatcatggccgctgaagacaacggagccctggcttccgccattgag
agcggcgaagtttcctacttgacccgtttcccggggatcggcaagaagacggcatcccag
atcgtcctggacttgcgggggaagatgggcaactatgtggcggaaaacctctttaccgaa
gatgaaccggttaagtctgttttcccagccctggaagacgccctcctggcccttggggct
ttgggctacagtcaaaaggaagttgaccggatcaagccgaaactgaagaaactgccggaa
atgtccgctgacgaatacatcaagcaggggctgggctttttgctgaagaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system