KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb1633Help
Entry
Ldb1633           CDS       T00364                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ldb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ldb1633 (recR)
DNA repair and recombination proteins [BR:ldb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Ldb1633 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1405062..1405661)
Genome map
AA seq 199 aa AA seqDB search
MQYPLPIARLIDSFMKLPGIGEKTATRLAFYAMDMPKEDVDEFAQALVDVKEKLRQCSVC
GNITEQDPCAICSNPVRDRSTIMVVEEAKDVMAFENMGEYDGLYHVLHGVLSPMDGIGPE
QINIKSLIVRLQKNDAAKEVILALNSTPEGESTAMYISRLIKPAGLKVTRLAAGLAVGSD
IEYANLITLKRAVQGRTEL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatacccattgccaatcgcccgcttgatcgattccttcatgaaactgccgggcatc
ggtgaaaagacggcgacccgcctggccttttacgccatggacatgcctaaagaagacgtg
gacgaattcgcccaggctctggtcgacgttaaggaaaagctgcgccagtgctcggtctgc
ggcaacatcaccgaacaagacccttgcgccatctgcagcaatccagtccgggatcggtca
accatcatggtggttgaggaagccaaggacgtgatggcctttgaaaatatgggcgaatat
gacggcctctaccatgtcctgcatggggtcttgtccccgatggacgggatcgggccggag
cagatcaacatcaagtccttgatcgtccgcctgcagaaaaatgatgctgccaaagaagtc
atcctggcccttaattccaccccggaaggggagtcaacggccatgtacatttcccgcttg
atcaagccggccggcctcaaggttacccggctggccgcgggcctggcggtcggctcagac
attgagtatgccaacttgatcactttgaagcgggcagttcaaggtagaacggagctatag

DBGET integrated database retrieval system