KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb1685Help
Entry
Ldb1685           CDS       T00364                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:ldb00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1439737..1441239)
Genome map
AA seq 500 aa AA seqDB search
MANKKIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGTLVLRIEDTDTARNVEGGAESQ
IENLHWLGIDWDEGPDIGGDYGPYKQSERKDIYQKYIDQLLEEGKAYYSFKTEEELEAQR
EEQRAMGIAPHYVYEYEGMTTDEIKQAQDEARAKGLKPVVRIHIPEGVTYEWDDIVKGHL
SFESDTIGGDFVIQKRDGMPTYNFAVVIDDHLMEISHVLRGDDHISNTPKQLCVYEALGW
EAPVFGHMTLIINSATGKKLSKRDESVLQFIEQYRELGFLPEAMFNFITLLGWSPVGESE
IFSKREFIKQFDPARLSKSPAAFDQKKLDWVNNQYMKTADRDELLDLALHNLQEAGLVEA
NPAPGKMEWVRQLVNMYANQMSYTKQIVDLSKIFFTEAKYLTDEEVEEIKKDEARPAIEE
FKKQLDKLDNFTAKKIMGAIMATRRETGIKGRKLFMPIRIATTRSMVGPGIGEAMELMGK
DTVMKHLDLTLKQLSEAGIE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
ttggctaataagaaaatccgcgtgagatacgctccgtcaccaactggccacttgcacatt
ggtaacgcgcgtactgctctgtttaactatctgtttgcacgtcacaacaaggggactttg
gttctgagaatcgaagacactgacaccgccagaaacgttgaaggcggggctgaatctcaa
atcgaaaacctgcactggctggggatcgactgggatgaaggtccggacatcggtggggac
tacggcccttacaagcagtccgaaagaaaggacatctaccaaaagtacatcgaccagctg
cttgaagaaggcaaggcttactactcctttaaaactgaagaagaactggaagcccagcgt
gaagaacagcgggccatggggattgctcctcactatgtctacgaatacgaaggcatgact
actgacgaaatcaagcaggcacaagacgaagcccgggccaagggcttgaagccagttgtc
cgcattcacattccagaaggcgtgacttacgaatgggacgacatcgttaagggccacttg
agctttgaatccgacactatcggcggtgacttcgtcatccaaaagcgcgacgggatgcca
acttacaactttgccgtcgttatcgacgaccacttgatggaaatcagccacgtgctccgg
ggcgatgaccacatctctaacacgccaaagcagctttgcgtttacgaagctttgggctgg
gaagctccagtcttcggccacatgactttgatcatcaactccgctactggcaagaagctg
tccaagcgtgacgaatcagtcctgcagttcatcgaacaatacagagaacttggtttcctg
ccagaagccatgttcaacttcatcactttgttgggctggtcgccagttggcgaaagcgaa
atcttctccaagcgcgaattcatcaagcaatttgacccggcccgtctgtccaagtcccca
gctgcctttgaccaaaagaagctggactgggtcaacaaccagtacatgaagacggctgac
agagatgaacttttggacctggccctgcacaacctgcaagaagctggcctggttgaagct
aacccggctccaggcaagatggaatgggtaagacaattggtgaacatgtacgccaaccaa
atgtcctacaccaagcaaatcgttgacttaagcaagatcttcttcactgaagcaaaatac
ctgactgacgaagaagtggaagaaatcaagaaggacgaagctcgtccggcgattgaagaa
ttcaagaagcaactggacaagctggacaatttcacggccaagaagatcatgggcgccatc
atggctacccggagggaaactggcatcaagggccgcaagctcttcatgccaatccggatc
gctactacccggtcaatggtcggccctggcatcggcgaagctatggaattgatgggcaag
gacacggtcatgaagcacctggacttgaccttgaagcagcttagcgaagctggcatcgaa
taa

DBGET integrated database retrieval system