KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb1734Help
Entry
Ldb1734           CDS       T00364                                 

Gene name
gpmA2
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ldb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ldb1734 (gpmA2)
   01230 Biosynthesis of amino acids
    Ldb1734 (gpmA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ldb1734 (gpmA2)
  Energy metabolism
   00680 Methane metabolism
    Ldb1734 (gpmA2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ldb1734 (gpmA2)
Enzymes [BR:ldb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Ldb1734 (gpmA2)
Exosome [BR:ldb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Ldb1734 (gpmA2)
  Exosomal proteins of melanoma cells
   Ldb1734 (gpmA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1480942..1481619)
Genome map
AA seq 225 aa AA seqDB search
MAKLALLRHGESQANAANVYTGWNDVPLTDKGRRQAWAAGEKLKEVGDFHPTMIHTSLLS
RAIETANIVAEAAGFLYLHVAKTWRLNERHYGALRGLDKDVSRKIFGKEQVLEWRRGCDA
VPPAQGSPTIDRRYWGVDPQLLPRAESLHQTQLRLLPYYEDEVASRLVAGEDQLIVAHGS
SLRALIKYLEDINNVDILKLEVPNAQAIVYDFDQELNIVDKMITN
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagttggcactgctgaggcatggggaaagccaggccaatgcggcaaacgtatat
acaggctggaatgacgtccccttaacggataagggccggcggcaggcctgggcagcaggg
gagaaattaaaagaagtcggggactttcacccgactatgattcacacttcccttttgtcg
agggcaattgagacggcgaacatcgtggccgaagccgcgggctttttatacctgcatgtt
gcaaagacctggcggctgaatgaacgccactacggggccctgcggggcctggacaaggac
gtgtccaggaagattttcggcaaagagcaggttttagagtggcggcggggctgtgacgcg
gtcccgccagcgcaagggtcaccaactatcgaccgccgctattggggagtggaccctcag
cttttgccaagagcggagagcctgcaccagacccagctgcgtttgttgccttactatgaa
gacgaggtggccagccgcttagtggctggggaagaccagctgatcgtggcccatggctcc
agcctgcgggcgctgatcaaatatttagaagatatcaacaatgtggatatcctaaagctg
gaggtgcctaacgcccaggccattgtctatgactttgaccaggagctgaacattgtggat
aagatgatcaccaactga

DBGET integrated database retrieval system