KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb1761Help
Entry
Ldb1761           CDS       T00364                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ldb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ldb1761 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ldb1761 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ldb1761 (thrC)
Enzymes [BR:ldb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ldb1761 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1497815..1499293
Genome map
AA seq 492 aa AA seqDB search
MIYRSTRSQGQEVTTAQAIVQGLAPDGGLFVPKEFPAPFSAAALKEIFALPYQDMAKKIL
ALFLTDYSAEQLAEIVKGAYGQQWDDDRIAPLTDKKAGNYYLELFHGPTLAFKDVALQCL
PRLMKTALENSDEHRGIVILTATSGDTGTAAMRGFQSLAKTRVIVFYPYQGVAPIQLKQM
LSENSDNTVAVAVEGNFDQAQTRVKQIFNDPDMNSLLADHDLTFSSANSMNVGRLLPQVV
YYFAAYKQLLDHEAIAFGDPVNFSVPTGNFGDILAGHYAQKLGLPVGRLICASNKNNVLT
DFFKTGKYDKKRDFYVTNSPSMDILVSSNLERLLFDLCQNPDTVKSLMERLNTKGEYQLP
EDMQKKLSGFWADYATPEEIEGEIKRVYEESGYVIDPHTAVASLAAKRFKEEDDKPTVVL
STASPYKFPETVYHAISGQTVKEKGLPALKELTDLAGPAPKAMEAFLGHSSQEIVIPADN
MANEVKRQLDLD
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccgcagtacccgcagccaggggcaggaagttaccactgcccaggcaatcgtc
caaggcctggccccagatggcggccttttcgtgcccaaagaattcccggctccattttca
gccgctgctttaaaggaaatttttgccctgccttaccaggatatggctaaaaagattctg
gctttgttcttaaccgactacagtgcagagcagctagcagagattgttaaaggcgcctac
ggccagcaatgggatgacgaccggatcgccccgctgactgataagaaggccggcaattac
tacttggagctcttccacgggccaaccctggcctttaaggacgtggccttgcagtgcctg
ccccgcttgatgaagacggccttggaaaactcagacgaacacagggggatcgtgattttg
acagcgacttccggggacaccgggaccgccgccatgcggggcttccagtccttagccaag
acccgggtcatcgtcttttacccttaccaaggggtggccccgatccagcttaagcagatg
ctgagcgaaaacagcgacaacaccgtggctgtagcggttgagggcaactttgaccaggcc
cagaccagggtcaagcagatttttaacgacccggacatgaacagtttgctggctgaccac
gatttgaccttctccagcgccaactccatgaatgttggccgcctcttgccccaggtcgtc
tactacttcgccgcctacaagcagctgctggaccatgaagccattgcctttggcgatccc
gtcaacttctccgtgccaactggcaatttcggcgacattctggccggccattatgctcaa
aaactgggcctgccagtcggccgcctgatctgcgcttccaacaagaacaatgtcttaacc
gactttttcaagacgggcaagtatgacaagaagcgggacttctacgtgaccaactcccca
tccatggacatcctggtttccagcaacctggagcgtctgctctttgacctctgccagaac
ccggacacggtcaagtctttgatggagcggctgaatacaaagggcgaataccaattgcca
gaagacatgcaaaagaagctttccggcttctgggccgactacgccactccggaagaaatc
gagggcgaaatcaaacgggtttacgaagaaagcggctatgtcatcgacccgcacacggct
gtcgcttctttagccgccaagcgctttaaggaagaagacgataagccaactgtcgtcctc
tctaccgccagcccttacaagttcccggaaaccgtctaccacgccatcagcgggcaaact
gttaaggaaaaaggcctgccagcccttaaggaactgactgacctagccggccctgcccca
aaggccatggaggccttcttaggccacagctcccaggaaatcgtcatcccggctgataac
atggcaaacgaagtcaagcggcagctggatctggactga

DBGET integrated database retrieval system