KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb1772Help
Entry
Ldb1772           CDS       T00364                                 

Gene name
pfk2
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ldb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ldb1772 (pfk2)
   01230 Biosynthesis of amino acids
    Ldb1772 (pfk2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ldb1772 (pfk2)
   00030 Pentose phosphate pathway
    Ldb1772 (pfk2)
   00051 Fructose and mannose metabolism
    Ldb1772 (pfk2)
   00052 Galactose metabolism
    Ldb1772 (pfk2)
  Energy metabolism
   00680 Methane metabolism
    Ldb1772 (pfk2)
Enzymes [BR:ldb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ldb1772 (pfk2)
Protein phosphatases and associated proteins [BR:ldb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ldb1772 (pfk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1504020..1505099
Genome map
AA seq 359 aa AA seqDB search
MTLRVGILTSGGDCQALNATMRGLSKTLYNCVDDVEIIGFKRGYYGLMHEDYVKMKPRDF
SGIINEGGTILGTSRQPFKEMRVIVDGFDKVAAMKKTYKKLNLDALAVLGGNGSLKSANM
LAQEGLNVIGLPKTIDNDTWGTDYTFGFQSAIDIATRYLDDIHTTAQSHSRVFVVEVMGH
KVGHITLAAGLAAGSDIILLPEIPYDINVVAKKVKERQKSGKGFTVIAAAEGAISKEDAT
LSKKKYKAKVAARNGASVVNEIAAQLQEVLPDAEIRTAVIGHAQRGGRPDAYDRQISTRF
GIEGARLIMNRSFGRLVVLKQGEVDSIALEDTAGKLKYVDPNGKTVSNARLMGVTFGDK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactttacgagttggtattttgacgagcggcggcgactgccaggcgctcaacgcgacc
atgcgggggctgtccaagaccctttacaactgtgtcgatgacgtggaaatcatcggtttc
aagcggggctactacggcttgatgcatgaagactacgtcaagatgaagccgcgggacttc
tccggcatcatcaacgaaggcgggacgattctgggcacttcccgccagccattcaaggaa
atgcgggtcatcgttgacggctttgacaaggtagccgccatgaagaagacctacaagaag
ctcaacctggacgctttggcggttttgggcggcaacgggtcacttaagtcagccaacatg
ctggcccaagaaggcttgaacgtgattggcctgccaaagaccatcgacaacgacacttgg
gggactgactacaccttcggtttccaaagcgccattgatattgccaccagatacctggat
gacatccacactactgctcaaagccactcccgggtctttgtcgtcgaagtcatgggccac
aaggttggccacatcaccctggccgccggcctggctgccggcagcgacattatcctttta
ccggaaatcccttatgacatcaatgtcgtggccaagaaggtcaaggaaagacaaaagtct
ggcaagggcttcacggtcattgccgccgctgaaggggcaatttccaaggaagacgccacc
ctgtccaagaagaagtacaaggctaaggttgccgctagaaacggcgccagcgtggttaac
gaaatcgctgcccaattgcaggaagttttgccagacgctgaaatcagaacggcggtcatc
ggccacgctcaacggggcggccggccagatgcctacgaccggcaaatctcaacccgcttc
gggattgaaggggcccgcctgatcatgaaccggtccttcggccgcctggttgtcttgaag
caaggcgaagtcgactctatcgccctggaagacacggccggcaagctcaagtacgttgac
ccgaacggcaagaccgtaagcaacgcccgccttatgggagtcacctttggggacaagtaa

DBGET integrated database retrieval system