KEGG   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842: Ldb2023Help
Entry
Ldb2023           CDS       T00364                                 

Gene name
gmk2
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ldb  Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ldb00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1689167..1689709)
Genome map
AA seq 180 aa AA seqDB search
MAKKIILIAGPSGAGKTTISEYLTDRYQIPRVITHTTRPKRSGESGSAYYFEDDDSFAQL
HFFEHVKYGDYQYGSSKEGLERAWAKNDLVSLIVDIKGARSYLEALGDQVYFLYVTCSLD
TLAQRMADRGDASDQIKNRLTGSELNELPEDLASCAHVLVNDDLQATYASLDSLVRKLQN
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaaaaaattatcttgattgccggtcccagcggggcgggcaagacgactatatct
gaatacctgaccgaccgctaccagatcccccgggtgattacccataccacccggccaaag
cggtctggggaaagcgggtcagcctattattttgaagacgatgattcttttgcccaactg
cacttctttgaacatgtcaaatacggggactaccagtacgggtccagtaaagaagggctg
gaaagagcctgggccaagaacgacctggtcagcttgatcgtggacatcaagggagcccgg
tcctacctggaagctttaggtgaccaggtttacttcctttatgtgacttgcagcctggat
accttggcgcaaagaatggctgaccggggtgatgcaagtgaccagatcaagaatcggctg
accggcagcgagttgaacgaattgccggaagatttggcttcttgcgcccatgtcctggtc
aatgacgacctgcaagcgacctatgccagcttggacagtttggtgagaaaattacaaaat
taa

DBGET integrated database retrieval system